Project name: query_structure

Status: done

Started: 2026-03-17 01:25:47
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVHFYFITYGETGVYGAGPQAFKVPGSKSTATISGLSPGVDYTITVYARRYHYPGGYYSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:42)
Show buried residues

Minimal score value
-2.7503
Maximal score value
1.8115
Average score
-0.382
Total score value
-35.9079

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8115
2 S A 0.8703
3 S A 0.5797
4 V A 0.5528
5 P A 0.0000
6 T A -1.5908
7 K A -2.6083
8 L A 0.0000
9 E A -1.9203
10 V A 0.0953
11 V A 1.5422
12 A A 0.8976
13 A A 0.3135
14 T A -0.2036
15 P A -0.8048
16 T A -0.5339
17 S A -0.3185
18 L A 0.0000
19 L A 0.7489
20 I A 0.0000
21 S A -0.9574
22 W A 0.0000
23 D A -2.5959
24 A A -1.2486
25 P A 0.0273
26 A A 0.4327
27 V A 0.3450
28 T A -0.4035
29 V A 0.0000
30 H A -1.3873
31 F A -1.1500
32 Y A 0.0000
33 F A 0.2287
34 I A 0.0000
35 T A -0.3504
36 Y A -0.6280
37 G A -0.7655
38 E A -1.0943
39 T A -0.8075
40 G A 0.2044
41 V A 1.4847
42 Y A 1.5686
43 G A 0.4180
44 A A 0.0074
45 G A -0.5702
46 P A -0.7859
47 Q A -1.2329
48 A A -0.5331
49 F A -0.2759
50 K A -1.2055
51 V A 0.0000
52 P A -1.2234
53 G A -1.5227
54 S A -1.2702
55 K A -2.1248
56 S A -1.3856
57 T A -0.7488
58 A A 0.0000
59 T A 0.2374
60 I A 0.0000
61 S A -0.4771
62 G A -0.6868
63 L A 0.0000
64 S A -0.9813
65 P A -1.1099
66 G A -1.2928
67 V A -1.3894
68 D A -2.5831
69 Y A 0.0000
70 T A -1.0879
71 I A 0.0000
72 T A 0.0000
73 V A 0.0000
74 Y A 0.4232
75 A A 0.0000
76 R A -0.7781
77 R A -1.0654
78 Y A 0.0776
79 H A -0.2552
80 Y A 0.7400
81 P A 0.2353
82 G A 0.0822
83 G A 0.3931
84 Y A 1.2506
85 Y A 0.8910
86 S A 0.0000
87 P A 0.4968
88 I A 0.2205
89 S A -0.5118
90 I A -0.7213
91 N A -1.9668
92 Y A -1.7841
93 R A -2.7503
94 T A -1.3953
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018