Project name: query_structure

Status: done

Started: 2026-03-17 01:22:03
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGAYWSYQEFTVPGSKTTATISGLKPGVDYTITVYAYWEHMYHYSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:49)
Show buried residues

Minimal score value
-2.6367
Maximal score value
1.8353
Average score
-0.4111
Total score value
-37.4103

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8353
2 S A 0.8918
3 S A 0.8511
4 V A 0.5829
5 P A 0.0000
6 T A -1.6230
7 K A -2.6210
8 L A 0.0000
9 E A -1.9097
10 V A 0.1324
11 V A 1.5657
12 A A 0.9202
13 A A 0.3376
14 T A -0.3411
15 P A -1.1251
16 T A -0.9980
17 S A -0.5215
18 L A 0.0000
19 L A 0.8035
20 I A 0.0000
21 S A -0.9353
22 W A 0.0000
23 D A -2.6367
24 A A -1.1933
25 P A 0.1155
26 A A 0.5682
27 V A 0.5613
28 T A -0.4185
29 V A -0.9424
30 D A -2.0979
31 H A -1.4771
32 Y A 0.0000
33 V A 0.1198
34 I A 0.0000
35 T A 0.0000
36 Y A -0.7011
37 G A 0.0000
38 E A -1.0963
39 T A -0.8976
40 G A -0.2678
41 A A 0.5295
42 Y A 1.7221
43 W A 1.6206
44 S A 0.3825
45 Y A 0.0252
46 Q A -1.4228
47 E A -1.8492
48 F A -0.5145
49 T A -0.1495
50 V A 0.0000
51 P A -1.2575
52 G A -1.4496
53 S A -1.4393
54 K A -2.0442
55 T A -1.4070
56 T A -0.7207
57 A A 0.0000
58 T A 0.2584
59 I A 0.0000
60 S A -0.6538
61 G A -1.0270
62 L A 0.0000
63 K A -2.3741
64 P A -1.6596
65 G A -1.4567
66 V A -1.4398
67 D A -2.0720
68 Y A 0.0000
69 T A -0.8609
70 I A 0.0000
71 T A -0.1539
72 V A 0.0000
73 Y A 0.7495
74 A A 0.0000
75 Y A 0.0819
76 W A -0.6338
77 E A -2.0182
78 H A -1.0328
79 M A 0.7606
80 Y A 1.3877
81 H A 0.6669
82 Y A 1.5393
83 S A 0.8121
84 P A 0.4770
85 I A 0.2841
86 S A -0.4925
87 I A -0.7346
88 N A -1.7549
89 Y A -1.5058
90 R A -2.5498
91 T A -1.5151
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018