Project name: 294a5dba2fff2bd

Status: done

Started: 2026-06-25 12:20:03
Settings
Chain sequence(s) A: MSHHHHHHSGMPAAAVVVNVVDVMKKNGMNYNEGLAMYKQASEQMYDTLRTSRDPDEISESIMMHAVSLVFLMEIATPENLQEFVQWVRGDGKWLHYVPDQMFWDRPTDAWWEMDPAARKAFRIIYNIMDYIDKTDPKDLEEIGAFLKETTAKLVALIEQWAANNPEQFEKMMAKMEKIAKQVKEGLQKTNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:57)
Show buried residues

Minimal score value
-4.0342
Maximal score value
1.0277
Average score
-1.3255
Total score value
-254.503

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5612
2 S A -0.6099
3 H A -1.7272
4 H A -2.3313
5 H A -2.7133
6 H A -2.7313
7 H A -2.5391
8 H A -2.0936
9 S A -1.2949
10 G A -0.8730
11 M A -0.0700
12 P A -0.1849
13 A A -0.2914
14 A A 0.2175
15 A A 0.1727
16 V A 0.0000
17 V A 0.0000
18 V A 1.0277
19 N A -0.8946
20 V A 0.0000
21 V A 0.0000
22 D A -1.7720
23 V A -1.5156
24 M A 0.0000
25 K A -3.1665
26 K A -2.9253
27 N A -2.4300
28 G A -2.1104
29 M A 0.0000
30 N A -1.8920
31 Y A -1.1602
32 N A -1.4238
33 E A 0.0000
34 G A 0.0000
35 L A 0.0000
36 A A -0.6910
37 M A 0.0000
38 Y A 0.0000
39 K A -1.7267
40 Q A -1.8466
41 A A 0.0000
42 S A 0.0000
43 E A -3.0029
44 Q A -2.4586
45 M A 0.0000
46 Y A -1.9721
47 D A -2.9641
48 T A 0.0000
49 L A 0.0000
50 R A -3.0236
51 T A -1.8799
52 S A 0.0000
53 R A -3.6981
54 D A -3.7220
55 P A -3.0667
56 D A -3.5532
57 E A -3.1571
58 I A 0.0000
59 S A 0.0000
60 E A -1.4174
61 S A 0.0000
62 I A 0.0000
63 M A 0.0000
64 M A 0.0000
65 H A 0.0000
66 A A 0.0000
67 V A 0.0000
68 S A 0.0000
69 L A 0.0000
70 V A 0.0000
71 F A 0.0000
72 L A 0.0000
73 M A 0.0000
74 E A -2.0151
75 I A -0.8647
76 A A -1.2247
77 T A -1.1728
78 P A -1.7392
79 E A -2.6206
80 N A -2.0874
81 L A -1.7645
82 Q A -2.8322
83 E A -3.0348
84 F A 0.0000
85 V A 0.0000
86 Q A -2.6767
87 W A -2.0718
88 V A 0.0000
89 R A -2.5540
90 G A -2.1139
91 D A -2.5703
92 G A 0.0000
93 K A -2.4231
94 W A -0.8539
95 L A 0.0000
96 H A -0.3986
97 Y A 0.5676
98 V A 0.0000
99 P A 0.1233
100 D A 0.1559
101 Q A -0.3943
102 M A 0.0000
103 F A 0.9496
104 W A 0.3506
105 D A -2.0189
106 R A -2.1902
107 P A -1.3729
108 T A -2.2179
109 D A -2.5718
110 A A 0.0000
111 W A -1.3263
112 W A -0.3913
113 E A -2.4180
114 M A 0.0000
115 D A -1.5473
116 P A -1.1182
117 A A 0.0000
118 A A 0.0000
119 R A -1.7776
120 K A -2.5696
121 A A 0.0000
122 F A 0.0000
123 R A -2.4072
124 I A 0.0000
125 I A 0.0000
126 Y A -0.5648
127 N A -0.8748
128 I A 0.0000
129 M A 0.0000
130 D A -1.0761
131 Y A -0.8563
132 I A 0.0000
133 D A -2.4657
134 K A -2.3879
135 T A -2.4074
136 D A -2.9459
137 P A -3.2305
138 K A -3.4604
139 D A -4.0342
140 L A -3.1436
141 E A -3.3711
142 E A -3.6005
143 I A 0.0000
144 G A -2.1313
145 A A -1.9254
146 F A -1.4313
147 L A 0.0000
148 K A -3.1367
149 E A -2.8791
150 T A -1.8974
151 T A 0.0000
152 A A -1.6179
153 K A -2.3334
154 L A 0.0000
155 V A -0.0516
156 A A -0.5750
157 L A -0.8531
158 I A 0.0000
159 E A -0.7015
160 Q A -1.2819
161 W A 0.0000
162 A A 0.0000
163 A A -1.2965
164 N A -1.9706
165 N A -2.1828
166 P A -2.3420
167 E A -3.2159
168 Q A -2.9540
169 F A 0.0000
170 E A -3.4338
171 K A -3.2916
172 M A 0.0000
173 M A -2.0831
174 A A -2.1104
175 K A -2.3099
176 M A 0.0000
177 E A -2.4655
178 K A -3.1190
179 I A -2.2523
180 A A 0.0000
181 K A -3.6664
182 Q A -3.2994
183 V A -2.5115
184 K A -3.1524
185 E A -3.7238
186 G A -2.7533
187 L A -2.2924
188 Q A -3.3043
189 K A -3.2789
190 T A -2.1249
191 N A -2.2978
192 S A -1.6917
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018