Project name: PRL_1 [mutate: CS4A]

Status: done

Started: 2026-07-28 02:13:37
Settings
Chain sequence(s) A: LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues CS4A
Energy difference between WT (input) and mutated protein (by FoldX) 0.580904 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:03:18)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:03:21)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:49)
Show buried residues

Minimal score value
-4.3301
Maximal score value
2.1186
Average score
-1.0124
Total score value
-201.4611

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 1.8708
2 P A 1.3018
3 I A 2.1186
4 S A 0.4547 mutated: CS4A
5 P A -0.0767
6 G A -0.6165
7 G A -0.9720
8 A A -1.0908
9 A A -1.0410
10 R A -1.8210
11 C A -0.8157
12 Q A -0.3554
13 V A 0.9818
14 T A -0.0143
15 L A -0.5467
16 R A -1.8581
17 D A -1.3947
18 L A -0.9486
19 F A 0.0000
20 D A -1.9083
21 R A -1.9998
22 A A 0.0000
23 V A -0.2153
24 V A 0.9561
25 L A 0.3064
26 S A 0.0000
27 H A -0.1492
28 Y A 0.6421
29 I A 0.0000
30 H A -1.7898
31 N A -1.7898
32 L A 0.0000
33 S A 0.0000
34 S A -2.0272
35 E A -2.3993
36 M A 0.0000
37 F A 0.0000
38 S A -2.2267
39 E A -2.4661
40 F A 0.0000
41 D A -2.3818
42 K A -3.3731
43 R A -3.1866
44 Y A -2.3308
45 T A 0.0000
46 H A -2.7691
47 G A -1.4913
48 R A -1.1462
49 G A -0.1820
50 F A 0.9981
51 I A 0.0568
52 T A -0.2520
53 K A -1.0545
54 A A -0.5488
55 I A -0.2045
56 N A -0.9010
57 S A -0.5508
58 C A 0.0000
59 H A -0.2821
60 T A 0.0000
61 S A -0.6899
62 S A -0.0727
63 L A 0.3673
64 A A -0.4059
65 T A -0.9802
66 P A 0.0000
67 E A -3.3624
68 D A -4.3076
69 K A -4.2715
70 E A -4.3301
71 Q A -3.8486
72 A A -3.6505
73 Q A -3.5888
74 Q A -3.2461
75 M A -2.6797
76 N A -2.8049
77 Q A -2.7526
78 K A -2.1265
79 D A -2.0971
80 F A 0.0000
81 L A 0.0000
82 S A -0.9011
83 L A 0.0000
84 I A 0.0000
85 V A 0.0000
86 S A 0.0000
87 I A 0.0000
88 L A 0.0000
89 R A -0.3305
90 S A 0.3357
91 W A 0.0000
92 N A -1.2796
93 E A -0.8927
94 P A 0.0000
95 L A 0.0000
96 Y A 0.5159
97 H A -0.1086
98 L A 0.0000
99 V A 0.0000
100 T A -0.5679
101 E A -1.1614
102 V A 0.0000
103 R A -2.8804
104 G A -2.1749
105 M A -2.1679
106 Q A -2.7052
107 E A -2.9422
108 A A 0.0000
109 P A -2.5563
110 E A -2.6331
111 A A -1.4983
112 I A 0.0000
113 L A -1.4127
114 S A -1.2077
115 K A -1.6985
116 A A 0.0000
117 V A -1.0179
118 E A -1.8142
119 I A 0.0000
120 E A -1.8342
121 E A -2.6504
122 Q A -1.9025
123 T A 0.0000
124 K A -3.0009
125 R A -3.4706
126 L A 0.0000
127 L A 0.0000
128 E A -2.8071
129 G A 0.0000
130 M A 0.0000
131 E A -2.2017
132 L A -0.6650
133 I A 0.0000
134 V A 0.0000
135 S A -1.8958
136 Q A -1.3264
137 V A -0.4163
138 H A -1.5297
139 P A -2.0279
140 E A -2.8767
141 T A -2.8631
142 K A -3.4904
143 E A -3.4093
144 N A -2.1665
145 E A -0.9780
146 I A 1.7603
147 Y A 1.9934
148 P A 1.6104
149 V A 1.9714
150 W A 0.7542
151 S A 0.1566
152 G A -0.0801
153 L A -0.2579
154 P A -0.3965
155 S A -0.5193
156 L A -0.5509
157 Q A -1.3605
158 M A -1.3358
159 A A -1.5813
160 D A -2.9475
161 E A -2.7412
162 E A -2.4024
163 S A -1.8826
164 R A -1.7260
165 L A 0.0000
166 S A -0.5079
167 A A 0.0000
168 Y A 0.0000
169 Y A 0.0000
170 N A -0.4618
171 L A 0.0000
172 L A 0.0000
173 H A -1.2662
174 C A 0.0000
175 L A 0.0000
176 R A -2.8463
177 R A -2.9613
178 D A 0.0000
179 S A 0.0000
180 H A -2.2176
181 K A -1.7593
182 I A 0.0000
183 D A 0.0000
184 N A -1.0158
185 Y A 0.0000
186 L A 0.0000
187 K A -1.2221
188 L A -0.8287
189 L A -0.9045
190 K A -1.7784
191 C A -1.9866
192 R A -2.4925
193 I A -1.2738
194 I A -1.4216
195 H A -2.4115
196 N A -2.8242
197 N A -2.5305
198 N A -1.6973
199 C A -0.5673
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018