Project name: RSVAseq52

Status: done

Started: 2026-06-14 09:58:15
Settings
Chain sequence(s) A: QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWFRQAPGQGLEAVAISSGGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAESGYGYGDYGGYNYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:11)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:12)
Show buried residues

Minimal score value
-2.936
Maximal score value
1.7497
Average score
-0.5426
Total score value
-66.1949

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.5474
2 V A -0.9886
3 Q A -1.1047
4 L A 0.0000
5 V A 1.1190
6 E A 0.3330
7 S A -0.2519
8 G A -0.9428
9 G A -0.0184
10 G A 0.6585
11 L A 1.4332
12 V A -0.0722
13 Q A -1.4499
14 P A -1.8442
15 G A -1.5762
16 G A -1.0591
17 S A -1.1761
18 L A -0.9272
19 R A -2.1850
20 L A 0.0000
21 S A -0.4792
22 C A 0.0000
23 A A -0.1519
24 A A 0.0000
25 S A -0.9398
26 G A -1.0595
27 F A -0.4416
28 T A -0.3743
29 F A 0.0000
30 S A -1.0390
31 S A -0.3342
32 Y A 0.0000
33 A A -0.1855
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A 0.0000
39 Q A -0.4312
40 A A -0.8488
41 P A -0.9596
42 G A -1.2228
43 Q A -1.6896
44 G A -0.9211
45 L A 0.2134
46 E A -0.4734
47 A A 0.0139
48 V A 0.0000
49 A A 0.0000
50 I A 0.0000
51 S A 0.0000
52 S A -0.6206
53 G A -0.9425
54 G A -0.9792
55 G A -0.9969
56 S A -0.5245
57 T A 0.0038
58 Y A 0.3490
59 Y A -0.4554
60 A A 0.0000
61 D A -2.4019
62 S A -1.7933
63 V A 0.0000
64 K A -2.5195
65 G A -1.7545
66 R A -1.5394
67 F A 0.0000
68 T A -0.7639
69 I A 0.0000
70 S A -0.6279
71 R A -1.4110
72 D A -2.0522
73 N A -2.5460
74 S A -2.0029
75 K A -2.6482
76 N A -2.0504
77 T A -1.2277
78 L A 0.0000
79 Y A -0.6765
80 L A 0.0000
81 Q A -1.2658
82 M A 0.0000
83 N A -1.5475
84 S A -1.4623
85 L A 0.0000
86 R A -2.9360
87 A A -2.0230
88 E A -2.4676
89 D A 0.0000
90 T A -0.4878
91 A A 0.0000
92 V A 0.9880
93 Y A 0.0000
94 Y A 0.4983
95 C A 0.0000
96 A A 0.0000
97 A A 0.0000
98 E A -0.3741
99 S A -0.5082
100 G A 0.1171
101 Y A 1.1171
102 G A 0.4268
103 Y A 0.7168
104 G A -0.5150
105 D A -1.2936
106 Y A 0.1532
107 G A -0.7543
108 G A -0.7643
109 Y A -0.3944
110 N A -1.1277
111 Y A -0.1915
112 W A 0.1829
113 G A 0.0178
114 Q A -0.8227
115 G A 0.1397
116 T A 0.6280
117 L A 1.7497
118 V A 0.0000
119 T A 0.3518
120 V A 0.0000
121 S A -0.7457
122 S A -0.4948
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018