Project name: query_structure

Status: done

Started: 2026-03-16 19:56:55
Settings
Chain sequence(s) A: CAKKRNWCGKNEDCCCPMKCIYAWYNQQGSCQTTITGLFKKC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:26)
Show buried residues

Minimal score value
-3.5459
Maximal score value
2.2858
Average score
-0.5881
Total score value
-24.7

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 C A -0.1359
2 A A -1.3436
3 K A -2.6129
4 K A -2.6317
5 R A -3.0535
6 N A -2.3352
7 W A -1.3214
8 C A -1.9658
9 G A -1.8661
10 K A -2.9521
11 N A -3.0545
12 E A -3.5459
13 D A -2.8908
14 C A -1.6794
15 C A -0.2005
16 C A -0.0877
17 P A 0.6966
18 M A -0.1493
19 K A -0.9287
20 C A 0.0000
21 I A 0.1730
22 Y A 0.5633
23 A A 1.0377
24 W A 1.4285
25 Y A 1.0496
26 N A -0.7525
27 Q A -1.7061
28 Q A -1.0769
29 G A 0.0000
30 S A -0.9696
31 C A 0.0000
32 Q A -0.8687
33 T A 0.3172
34 T A 1.2545
35 I A 2.2858
36 T A 1.3385
37 G A 0.0000
38 L A 2.1645
39 F A 1.9423
40 K A -0.1061
41 K A -0.8948
42 C A 0.1782
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018