Project name: C_1

Status: done

Started: 2025-02-27 09:31:29
Settings
Chain sequence(s) A: MGSHHHHHHMQKKNQIAAAIVLRGLAKDGKFANTGGGGSGGGGMKKSDKIAAAIVLRGLAKDGKFAAAGGGGSGGGGQNKNDQIAAAIVLRGLAKGGKFANAGGGGSGGGGKKKNDQIAAALVLRGVAKSGKFAGAGGGGSGGGGITRNDEIAAAIVLRGMAKGGRFFASGGGGSGGGGMKKDDQIAAAIALRGMAKDGKFAVKGGG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:39)
Show buried residues

Minimal score value
-3.7846
Maximal score value
2.452
Average score
-1.0525
Total score value
-217.8775

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3125
2 G A -1.2931
3 S A -1.2180
4 H A -2.1972
5 H A -2.6427
6 H A -2.7162
7 H A -2.9604
8 H A -3.5541
9 H A -3.4815
10 M A -2.9830
11 Q A -3.2128
12 K A -3.3876
13 K A -3.3569
14 N A -2.9329
15 Q A -1.7991
16 I A 1.0381
17 A A 0.6076
18 A A 0.9978
19 A A 1.4167
20 I A 2.4520
21 V A 1.8720
22 L A 0.5276
23 R A -1.4060
24 G A -1.0027
25 L A -1.2625
26 A A -2.3019
27 K A -3.4580
28 D A -3.6233
29 G A 0.0000
30 K A -3.0192
31 F A 0.0000
32 A A -1.8031
33 N A -2.2135
34 T A -1.5584
35 G A -1.2737
36 G A -1.2480
37 G A -0.9988
38 G A 0.0000
39 S A -1.3362
40 G A -1.7453
41 G A -1.7511
42 G A -1.9314
43 G A -2.3847
44 M A -2.2895
45 K A -2.7659
46 K A -1.5442
47 S A -0.9118
48 D A -1.0665
49 K A -0.8207
50 I A 0.4239
51 A A 0.5796
52 A A 0.0000
53 A A 0.0000
54 I A 1.3215
55 V A 1.3797
56 L A 0.5222
57 R A -1.3516
58 G A -0.2744
59 L A 0.7383
60 A A -1.2842
61 K A -2.6565
62 D A -3.4210
63 G A -2.8766
64 K A -3.5281
65 F A -1.4511
66 A A 0.0000
67 A A -0.2231
68 A A -1.0088
69 G A -0.8477
70 G A -1.1632
71 G A -1.1907
72 G A -0.9949
73 S A -1.3307
74 G A -1.5662
75 G A 0.0000
76 G A -1.2904
77 G A -1.3375
78 Q A -1.8772
79 N A 0.0000
80 K A -3.7846
81 N A 0.0000
82 D A -2.9087
83 Q A -2.6748
84 I A 0.0000
85 A A 0.0000
86 A A -0.3101
87 A A 0.0000
88 I A 0.0000
89 V A 1.3449
90 L A 1.7996
91 R A 0.0837
92 G A -0.0904
93 L A 1.4031
94 A A -0.1566
95 K A -1.5867
96 G A -1.4469
97 G A -1.5095
98 K A -2.5978
99 F A 0.0000
100 A A -1.5913
101 N A -1.7834
102 A A -1.0582
103 G A 0.0000
104 G A -1.3623
105 G A -1.1546
106 G A -1.3983
107 S A -1.1115
108 G A -1.6112
109 G A -1.8550
110 G A -1.6442
111 G A -2.3883
112 K A -2.9943
113 K A -2.6200
114 K A -2.6424
115 N A -1.5904
116 D A -1.7075
117 Q A -1.4771
118 I A -1.0325
119 A A 0.0000
120 A A 0.0000
121 A A 0.0000
122 L A 0.0000
123 V A 0.0000
124 L A 0.0000
125 R A -0.5768
126 G A 0.0000
127 V A 0.0000
128 A A 0.0000
129 K A -2.8490
130 S A -2.4779
131 G A -1.9875
132 K A -1.5214
133 F A 0.0000
134 A A -0.8428
135 G A 0.0000
136 A A 0.0000
137 G A -1.4279
138 G A -1.5546
139 G A -1.4683
140 G A -1.4484
141 S A -1.0807
142 G A -1.2126
143 G A -0.9601
144 G A -0.9943
145 G A -0.8295
146 I A -0.8089
147 T A -1.3506
148 R A -3.1049
149 N A -3.1413
150 D A -3.3289
151 E A -2.6917
152 I A 0.0000
153 A A -0.7978
154 A A -0.2683
155 A A 0.0000
156 I A 1.0557
157 V A 2.1036
158 L A 1.0278
159 R A -1.1213
160 G A -0.7269
161 M A -0.6440
162 A A -0.8282
163 K A -0.5455
164 G A 0.0000
165 G A 0.0000
166 R A -0.9369
167 F A -0.1305
168 F A 0.1605
169 A A 0.0000
170 S A -1.1587
171 G A -1.1343
172 G A -1.5284
173 G A -1.2794
174 G A -1.1699
175 S A -1.2222
176 G A -1.3965
177 G A -1.5467
178 G A -2.0162
179 G A -1.9626
180 M A -1.4182
181 K A -2.2949
182 K A -1.9654
183 D A -1.0888
184 D A 0.0000
185 Q A 0.0000
186 I A 0.0000
187 A A 0.7056
188 A A 0.0000
189 A A 0.0000
190 I A 0.0000
191 A A 0.1290
192 L A 0.0000
193 R A 0.0000
194 G A -0.9048
195 M A -0.5081
196 A A 0.0000
197 K A -2.7219
198 D A -2.3370
199 G A -2.2942
200 K A -2.2845
201 F A 0.0000
202 A A -0.8256
203 V A -1.0036
204 K A -2.1319
205 G A -1.8419
206 G A -1.5885
207 G A -1.3844
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018