Project name: 2adc1158fc097d7

Status: done

Started: 2026-05-14 02:49:11
Settings
Chain sequence(s) B: QRTESIIARALYYDLISYRRPRFNVQRTESIIARALYYDLIS
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:50)
Show buried residues

Minimal score value
-2.6588
Maximal score value
3.0671
Average score
0.5457
Total score value
22.9212

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q B -2.4542
2 R B -2.2873
3 T B -1.1453
4 E B -1.7003
5 S B -0.3729
6 I B 1.6888
7 I B 2.4123
8 A B 1.2354
9 R B 1.2083
10 A B 2.0109
11 L B 2.9390
12 Y B 3.0671
13 Y B 2.4618
14 D B 0.7546
15 L B 1.9262
16 I B 1.5040
17 S B 0.5857
18 Y B 0.5255
19 R B -1.9370
20 R B -2.6588
21 P B -1.9257
22 R B -1.9119
23 F B 0.5009
24 N B -0.6457
25 V B 0.1719
26 Q B -1.6792
27 R B -2.4543
28 T B -1.0212
29 E B -1.3876
30 S B -0.4870
31 I B 1.8357
32 I B 2.5407
33 A B 1.3138
34 R B 0.5565
35 A B 1.6411
36 L B 2.9455
37 Y B 3.0170
38 Y B 2.4316
39 D B 0.8304
40 L B 2.6860
41 I B 3.0639
42 S B 1.1350
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018