Project name: 2b07fc1418ce5aa

Status: done

Started: 2026-06-22 16:03:47
Settings
Chain sequence(s) B: SLRALMDEAMKAIKKLEEIAELVFEQNPDEELKERLEKKLKKLKELVEKL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:19)
Show buried residues

Minimal score value
-4.8756
Maximal score value
0.9914
Average score
-2.296
Total score value
-114.8

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B 0.1389
2 L B 0.9914
3 R B -1.1538
4 A B -0.7747
5 L B 0.3024
6 M B -1.2429
7 D B -3.0276
8 E B -2.9357
9 A B -1.8300
10 M B -2.5328
11 K B -3.5700
12 A B -2.7027
13 I B 0.0000
14 K B -3.6935
15 K B -3.4623
16 L B -1.6957
17 E B -2.7291
18 E B -2.6085
19 I B -0.5532
20 A B 0.0000
21 E B -2.3558
22 L B -0.1890
23 V B -0.5045
24 F B 0.0000
25 E B -2.5124
26 Q B -2.3757
27 N B -2.6883
28 P B -2.8118
29 D B -3.6334
30 E B -4.1603
31 E B -4.0765
32 L B -3.2324
33 K B -4.3064
34 E B -4.8756
35 R B -4.8036
36 L B -3.8193
37 E B -4.5510
38 K B -4.8485
39 K B -4.3236
40 L B 0.0000
41 K B -4.2071
42 K B -3.7485
43 L B -2.2963
44 K B -2.8390
45 E B -3.0638
46 L B -1.2479
47 V B 0.0000
48 E B -2.7380
49 K B -1.9130
50 L B 0.4015
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018