Project name: query_structure

Status: done

Started: 2026-03-16 23:22:24
Settings
Chain sequence(s) A: GIIPCGESCVFIPCITSIVGCSCKSKVCYKN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:19)
Show buried residues

Minimal score value
-1.757
Maximal score value
2.9998
Average score
0.7221
Total score value
22.3863

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A 0.2197
2 I A 2.2435
3 I A 2.2561
4 P A 0.7022
5 C A 0.6300
6 G A -0.0868
7 E A 0.1109
8 S A 0.5683
9 C A 1.2472
10 V A 2.2947
11 F A 2.8761
12 I A 2.2107
13 P A 1.3370
14 C A 0.0000
15 I A 2.5553
16 T A 1.9030
17 S A 1.7384
18 I A 2.9998
19 V A 2.4856
20 G A 0.6465
21 C A 0.0000
22 S A -0.3965
23 C A -0.4223
24 K A -1.7570
25 S A -1.2159
26 K A -0.9415
27 V A -0.6209
28 C A 0.0000
29 Y A -0.1476
30 K A -0.1798
31 N A -0.8704
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018