Project name: 2c5bd7b358f05f3

Chain sequence(s)	A: MGPPRRVCRAGLLFVLLVALAAGDAGPRGEPPGEEGGRDGIGGARCETQNTGQMSAPGALVPFYVGMASMGVCIIAHVCQICQRLLAAGHA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)

• Minimal score value: -3.3271
• Maximal score value: 4.9936
• Average score: 0.3997
• Total score value: 36.373

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.7443
2	G	A	-0.4878
3	P	A	-0.9631
4	P	A	-1.3977
5	R	A	-2.6848
6	R	A	-2.3699
7	V	A	0.1323
8	C	A	0.0290
9	R	A	-0.8601
10	A	A	0.9353
11	G	A	2.5181
12	L	A	3.3561
13	L	A	3.9586
14	F	A	4.6516
15	V	A	4.7072
16	L	A	4.9936
17	L	A	4.6921
18	V	A	3.4847
19	A	A	2.6313
20	L	A	2.5141
21	A	A	1.0589
22	A	A	0.6786
23	G	A	-0.5860
24	D	A	-1.8248
25	A	A	-1.0723
26	G	A	-1.7353
27	P	A	-2.1470
28	R	A	-2.9645
29	G	A	-2.4977
30	E	A	-2.8268
31	P	A	-2.1372
32	P	A	-1.7466
33	G	A	-2.1939
34	E	A	-3.2672
35	E	A	-3.3271
36	G	A	-2.7116
37	G	A	-2.6168
38	R	A	-2.9864
39	D	A	-2.7171
40	G	A	-0.9867
41	I	A	0.8372
42	G	A	-0.0141
43	G	A	-0.7300
44	A	A	-1.0704
45	R	A	-2.1419
46	C	A	-1.2327
47	E	A	-2.5296
48	T	A	-2.0942
49	Q	A	-2.2614
50	N	A	-2.5118
51	T	A	-1.4927
52	G	A	-1.4344
53	Q	A	-1.2940
54	M	A	-0.0585
55	S	A	-0.1351
56	A	A	0.3574
57	P	A	0.8037
58	G	A	0.5893
59	A	A	1.5610
60	L	A	3.1040
61	V	A	3.4545
62	P	A	2.5679
63	F	A	3.7627
64	Y	A	3.7387
65	V	A	2.9246
66	G	A	2.1257
67	M	A	2.1728
68	A	A	1.7758
69	S	A	2.1335
70	M	A	2.4178
71	G	A	1.9680
72	V	A	2.7212
73	C	A	2.8725
74	I	A	3.5330
75	I	A	3.6977
76	A	A	2.5450
77	H	A	1.5102
78	V	A	2.6807
79	C	A	1.8570
80	Q	A	0.7957
81	I	A	2.0270
82	C	A	1.4750
83	Q	A	-0.0223
84	R	A	-0.3762
85	L	A	1.4757
86	L	A	1.3339
87	A	A	0.2472
88	A	A	0.0174
89	G	A	-0.2591
90	H	A	-0.6946
91	A	A	-0.3352