Project name: query_structure

Status: done

Started: 2026-03-16 23:48:26
Settings
Chain sequence(s) A: HVQLVESGGGSVQAGGSLRLSCAASGYSYCSYDMSWYRQAPGKEREFVATIDSYGDTSYADSVKGRFTISQDNAKNTLYLQMNSLKPEDTAMYYCATTPYGGWRYFGYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:18)
Show buried residues

Minimal score value
-3.3543
Maximal score value
0.9915
Average score
-0.7098
Total score value
-84.4686

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 H A -1.2525
2 V A -0.6956
3 Q A -1.0700
4 L A 0.0000
5 V A 0.3355
6 E A 0.0000
7 S A -0.7349
8 G A -1.2335
9 G A -1.2055
10 G A -0.9369
11 S A -0.7091
12 V A -0.7534
13 Q A -1.5976
14 A A -1.6310
15 G A -1.3391
16 G A -1.0706
17 S A -1.2199
18 L A -1.1608
19 R A -2.1522
20 L A 0.0000
21 S A -0.4848
22 C A 0.0000
23 A A -0.3247
24 A A 0.0000
25 S A -0.7013
26 G A -0.9649
27 Y A -0.3325
28 S A -0.4519
29 Y A 0.0000
30 C A 0.2002
31 S A 0.4244
32 Y A 0.1656
33 D A -0.7739
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 Y A -0.0599
38 R A 0.0000
39 Q A -1.9415
40 A A -1.9771
41 P A -1.4349
42 G A -1.9636
43 K A -3.2818
44 E A -3.3543
45 R A -2.3497
46 E A -1.1966
47 F A -0.0348
48 V A 0.0000
49 A A 0.0000
50 T A -0.5773
51 I A 0.0000
52 D A -1.0293
53 S A -0.1393
54 Y A 0.3298
55 G A -0.9286
56 D A -1.9232
57 T A -1.1168
58 S A -0.9415
59 Y A -0.8727
60 A A -1.2475
61 D A -2.4276
62 S A -1.7686
63 V A 0.0000
64 K A -2.6644
65 G A -1.7918
66 R A -1.4977
67 F A 0.0000
68 T A -0.8845
69 I A 0.0000
70 S A -0.7098
71 Q A -1.0621
72 D A -1.5578
73 N A -1.8989
74 A A -1.5110
75 K A -2.3332
76 N A -1.6344
77 T A -1.0481
78 L A 0.0000
79 Y A -0.5849
80 L A 0.0000
81 Q A -1.2550
82 M A 0.0000
83 N A -1.4100
84 S A -1.2199
85 L A 0.0000
86 K A -2.2965
87 P A -1.8341
88 E A -2.2940
89 D A 0.0000
90 T A -1.1429
91 A A 0.0000
92 M A -0.6481
93 Y A 0.0000
94 Y A -0.1767
95 C A 0.0000
96 A A 0.0000
97 T A 0.0000
98 T A 0.3083
99 P A 0.5364
100 Y A 0.7929
101 G A -0.1499
102 G A -0.0752
103 W A 0.4619
104 R A -0.6696
105 Y A 0.8870
106 F A 0.9915
107 G A 0.6317
108 Y A 0.8874
109 W A 0.5041
110 G A -0.1551
111 Q A -0.9431
112 G A 0.0000
113 T A -0.8291
114 Q A -1.3575
115 V A 0.0000
116 T A -0.9513
117 V A 0.0000
118 S A -1.1313
119 S A -0.8442
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018