Project name: query_structure

Status: done

Started: 2026-03-16 23:22:54
Settings
Chain sequence(s) A: GIPCAESCVWIPCTVTALLGCSCKDKVCYLN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:53)
Show buried residues

Minimal score value
-2.9546
Maximal score value
2.7562
Average score
0.5186
Total score value
16.0766

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A 0.0727
2 I A 1.7298
3 P A 0.7040
4 C A 1.1585
5 A A 0.3759
6 E A 0.3927
7 S A 0.1370
8 C A 0.5174
9 V A 0.8854
10 W A 2.1431
11 I A 2.3971
12 P A 1.3244
13 C A 1.5505
14 T A 1.6107
15 V A 2.4510
16 T A 0.0000
17 A A 1.9187
18 L A 2.7562
19 L A 2.5308
20 G A 1.1241
21 C A 0.0000
22 S A -0.3642
23 C A -0.6617
24 K A -2.5923
25 D A -2.9546
26 K A -2.0277
27 V A -1.0578
28 C A 0.0000
29 Y A -0.0231
30 L A 0.7352
31 N A -0.7572
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018