Project name: 2cf3957f78e0a18

Chain sequence(s)	A: VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQ
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:35)

• Minimal score value: -4.1624
• Maximal score value: 1.1602
• Average score: -1.3631
• Total score value: -207.1888

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	V	A	1.1602
2	L	A	0.0097
3	S	A	-1.0386
4	E	A	-2.3556
5	G	A	-1.9077
6	E	A	-1.7572
7	W	A	0.0000
8	Q	A	-2.1006
9	L	A	-1.1618
10	V	A	0.0000
11	L	A	-1.0366
12	H	A	-0.8799
13	V	A	0.0000
14	W	A	0.0000
15	A	A	-0.9436
16	K	A	-1.6422
17	V	A	0.0000
18	E	A	-1.8160
19	A	A	-1.4440
20	D	A	-1.8892
21	V	A	-1.1000
22	A	A	-1.1658
23	G	A	-1.1981
24	H	A	0.0000
25	G	A	0.0000
26	Q	A	-1.5548
27	D	A	-1.9703
28	I	A	0.0000
29	L	A	0.0000
30	I	A	0.0000
31	R	A	-2.2256
32	L	A	0.0000
33	F	A	0.0000
34	K	A	-2.4125
35	S	A	-1.5445
36	H	A	-1.1596
37	P	A	-1.8952
38	E	A	-2.0787
39	T	A	0.0000
40	L	A	-2.6116
41	E	A	-3.6318
42	K	A	-2.9620
43	F	A	-2.9771
44	D	A	-3.8920
45	R	A	-3.8744
46	F	A	0.0000
47	K	A	-4.1624
48	H	A	-3.1531
49	L	A	-2.5544
50	K	A	-2.6632
51	T	A	-2.2109
52	E	A	-2.4096
53	A	A	-1.7927
54	E	A	-2.3984
55	M	A	0.0000
56	K	A	-2.6509
57	A	A	-1.9806
58	S	A	-2.5578
59	E	A	-3.5735
60	D	A	-3.6561
61	L	A	0.0000
62	K	A	-3.0284
63	K	A	-3.0131
64	H	A	-1.8086
65	G	A	0.0000
66	V	A	-0.3947
67	T	A	-0.0786
68	V	A	0.4165
69	L	A	0.0000
70	T	A	0.1399
71	A	A	0.2047
72	L	A	0.0000
73	G	A	0.0000
74	A	A	-0.8346
75	I	A	0.0000
76	L	A	0.0000
77	K	A	-2.7104
78	K	A	-2.8150
79	K	A	-2.7283
80	G	A	-1.6036
81	H	A	-2.4032
82	H	A	0.0000
83	E	A	-2.6917
84	A	A	-1.7361
85	E	A	-1.7877
86	L	A	0.0000
87	K	A	-2.7641
88	P	A	-1.7472
89	L	A	-0.9838
90	A	A	0.0000
91	Q	A	-2.2587
92	S	A	-1.9387
93	H	A	-1.5642
94	A	A	0.0000
95	T	A	-1.6422
96	K	A	-2.5954
97	H	A	-2.3125
98	K	A	-2.1752
99	I	A	-1.1613
100	P	A	-0.8407
101	I	A	-0.9245
102	K	A	-1.6387
103	Y	A	-1.0378
104	L	A	0.0000
105	E	A	-2.1460
106	F	A	-1.1995
107	I	A	-0.8923
108	S	A	0.0000
109	E	A	-2.2555
110	A	A	0.0000
111	I	A	0.0000
112	I	A	-1.1120
113	H	A	-2.0000
114	V	A	0.0000
115	L	A	0.0000
116	H	A	-1.8313
117	S	A	-1.7314
118	R	A	-2.6677
119	H	A	-1.9181
120	P	A	-1.5267
121	G	A	-1.2571
122	D	A	-1.5301
123	F	A	0.0000
124	G	A	-1.2388
125	A	A	-1.1758
126	D	A	-2.1375
127	A	A	0.0000
128	Q	A	-1.4758
129	G	A	-1.3933
130	A	A	0.0000
131	M	A	0.0000
132	N	A	-1.8591
133	K	A	-1.3278
134	A	A	0.0000
135	L	A	0.0000
136	E	A	-2.4819
137	L	A	0.0000
138	F	A	-1.2582
139	R	A	-2.0125
140	K	A	-2.3614
141	D	A	-2.0735
142	I	A	0.0000
143	A	A	-1.5752
144	A	A	-1.9233
145	K	A	-2.6794
146	Y	A	0.0000
147	K	A	-3.0741
148	E	A	-2.8684
149	L	A	-1.4369
150	G	A	-1.6378
151	Y	A	-1.6921
152	Q	A	-2.1597