Project name: query_structure

Status: done

Started: 2026-03-17 01:11:19
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVDYYVITYGETGYWPYYWQEFEVPGSKSTATISGLKPGVDYTITVYAAGHYNSYYYSYSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:31)
Show buried residues

Minimal score value
-3.2794
Maximal score value
2.4224
Average score
-0.3421
Total score value
-32.4979

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.6752
2 S A 0.3932
3 D A -0.1396
4 V A -0.4987
5 P A 0.0000
6 R A -2.9784
7 D A -3.2794
8 L A 0.0000
9 E A -2.0615
10 V A 0.1523
11 V A 1.5715
12 A A 0.9138
13 A A 0.3313
14 T A -0.3316
15 P A -1.1061
16 T A -0.9928
17 S A -0.5174
18 L A 0.0000
19 L A 0.7775
20 I A 0.0000
21 S A -1.1173
22 W A 0.0000
23 D A -3.1372
24 A A -1.5977
25 P A -0.3902
26 A A 0.2760
27 V A 0.6228
28 T A -0.0153
29 V A -0.4209
30 D A -0.8841
31 Y A -0.9982
32 Y A 0.0000
33 V A -0.6144
34 I A 0.0000
35 T A -1.0859
36 Y A -0.4758
37 G A 0.0000
38 E A -0.3224
39 T A -0.3862
40 G A 0.4484
41 Y A 2.1671
42 W A 2.2255
43 P A 1.5656
44 Y A 2.4224
45 Y A 1.9359
46 W A 0.5986
47 Q A -1.4225
48 E A -2.2331
49 F A -1.3555
50 E A -1.7891
51 V A 0.0000
52 P A -1.2838
53 G A -1.1757
54 S A -1.2158
55 K A -2.1205
56 S A -1.4252
57 T A -0.7572
58 A A 0.0000
59 T A 0.0752
60 I A 0.0000
61 S A -0.6527
62 G A -1.0254
63 L A 0.0000
64 K A -2.3575
65 P A -1.6676
66 G A -1.4680
67 V A -1.4174
68 D A -2.0308
69 Y A 0.0000
70 T A -0.5765
71 I A 0.0000
72 T A 0.0000
73 V A 0.0000
74 Y A 0.1768
75 A A 0.0000
76 A A 0.0000
77 G A 0.0000
78 H A 0.2796
79 Y A 1.0673
80 N A -0.3762
81 S A 0.3361
82 Y A 1.7479
83 Y A 1.9004
84 Y A 1.7109
85 S A 0.6067
86 Y A 0.3520
87 S A -0.0728
88 P A -0.1688
89 I A -0.2619
90 S A -0.6743
91 I A -0.7363
92 N A -1.7123
93 Y A -1.4617
94 R A -2.5262
95 T A -1.5120
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018