Project name: Nb_Hybrid

Chain sequence(s)	A: QVQLVESGGGLVQPGGSLRLSCAASGRTFSPYTWFRQAPGQGLEAVAIIGSDRSTDLDGDTRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAALTAKGYVFTDNEYDYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:40)

• Minimal score value: -2.8386
• Maximal score value: 1.7987
• Average score: -0.7194
• Total score value: -85.604

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.8578
2	V	A	-1.7329
3	Q	A	-1.3025
4	L	A	0.0000
5	V	A	1.2198
6	E	A	0.0000
7	S	A	-0.1337
8	G	A	-0.6118
9	G	A	0.1490
10	G	A	0.6848
11	L	A	1.3879
12	V	A	-0.0761
13	Q	A	-1.3909
14	P	A	-1.7440
15	G	A	-1.5200
16	G	A	-1.0473
17	S	A	-1.4841
18	L	A	-1.0863
19	R	A	-2.3351
20	L	A	0.0000
21	S	A	-0.4591
22	C	A	0.0000
23	A	A	-0.1599
24	A	A	0.0000
25	S	A	-1.3928
26	G	A	-1.9982
27	R	A	-2.3000
28	T	A	-1.3041
29	F	A	-0.4924
30	S	A	-0.3016
31	P	A	-0.2684
32	Y	A	0.0000
33	T	A	0.0000
34	W	A	0.0000
35	F	A	0.0000
36	R	A	-0.2833
37	Q	A	-0.5602
38	A	A	-0.9499
39	P	A	-1.1715
40	G	A	-1.2046
41	Q	A	-1.7190
42	G	A	-0.9550
43	L	A	0.1319
44	E	A	-0.7402
45	A	A	-0.3450
46	V	A	0.0000
47	A	A	0.0000
48	I	A	0.0000
49	I	A	-1.0969
50	G	A	-1.3793
51	S	A	-1.6476
52	D	A	-2.8215
53	R	A	-2.8386
54	S	A	-1.6408
55	T	A	-0.9247
56	D	A	-1.1044
57	L	A	-0.3054
58	D	A	-1.0911
59	G	A	-1.0139
60	D	A	-0.9517
61	T	A	-0.8374
62	R	A	-1.1686
63	F	A	0.0000
64	T	A	-0.9686
65	I	A	0.0000
66	S	A	-0.9852
67	R	A	-1.7069
68	D	A	-2.2976
69	N	A	-2.5778
70	S	A	-2.0429
71	K	A	-2.7039
72	N	A	-2.1695
73	T	A	0.0000
74	L	A	0.0000
75	Y	A	-0.9018
76	L	A	0.0000
77	Q	A	-1.7130
78	M	A	0.0000
79	N	A	-1.9669
80	S	A	-1.4394
81	L	A	0.0000
82	R	A	-2.6039
83	A	A	-1.8605
84	E	A	-2.3386
85	D	A	0.0000
86	T	A	-0.4700
87	A	A	0.0000
88	V	A	0.8069
89	Y	A	0.0000
90	Y	A	0.4484
91	C	A	0.0000
92	A	A	0.0000
93	A	A	0.0000
94	L	A	-1.0762
95	T	A	-1.0908
96	A	A	-1.0898
97	K	A	-1.1445
98	G	A	0.1562
99	Y	A	1.7331
100	V	A	1.6401
101	F	A	1.7987
102	T	A	-0.1107
103	D	A	-2.2188
104	N	A	-2.7785
105	E	A	-2.7688
106	Y	A	-1.7641
107	D	A	-1.8125
108	Y	A	-0.6052
109	W	A	0.2184
110	G	A	0.0866
111	Q	A	-0.5800
112	G	A	0.1745
113	T	A	0.6426
114	L	A	1.5821
115	V	A	0.0000
116	T	A	0.3363
117	V	A	0.0000
118	S	A	-0.7558
119	S	A	-0.5095