Project name: 2dc740e7b18afb8

Chain sequence(s)	A: PVLTQSPSVSAAPRQRVTISVSGSNSNIGSNTVNWIQQLPGRAPELLMYDDDLLAPGVSDRFSGSRSGTSASLTISGLQSEDEADYYAATWDDSLNGWVFGGGTKVTVL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:38)

• Minimal score value: -3.1315
• Maximal score value: 1.7268
• Average score: -0.6662
• Total score value: -72.6212

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
2	P	A	0.6009
3	V	A	1.7268
4	L	A	0.0000
5	T	A	0.0509
6	Q	A	0.0000
7	S	A	-0.6818
8	P	A	-0.9183
9	S	A	-0.8638
11	V	A	-0.2706
12	S	A	-0.0022
13	A	A	-0.4035
14	A	A	-0.4987
15	P	A	-1.6351
16	R	A	-3.0807
17	Q	A	-3.1315
18	R	A	-2.9842
19	V	A	0.0000
20	T	A	-0.5148
21	I	A	0.0000
22	S	A	-0.3804
23	V	A	0.0000
24	S	A	-0.3606
25	G	A	-0.3824
26	S	A	-0.9571
27	N	A	-1.9502
28	S	A	-1.4171
29	N	A	0.0000
30	I	A	0.0000
35	G	A	-1.3907
36	S	A	-1.1254
37	N	A	-1.0340
38	T	A	-1.1434
39	V	A	0.0000
40	N	A	-0.2198
41	W	A	0.0000
42	I	A	-0.0993
43	Q	A	-1.0847
44	Q	A	-1.5858
45	L	A	-1.7011
46	P	A	-1.5355
47	G	A	-1.4688
48	R	A	-2.4363
49	A	A	-1.5714
50	P	A	-1.5723
51	E	A	-1.8769
52	L	A	-0.2174
53	L	A	0.0000
54	M	A	0.0000
55	Y	A	-0.4235
56	D	A	-1.9892
57	D	A	-1.7996
65	D	A	-1.8740
66	L	A	-0.0944
67	L	A	0.0705
68	A	A	0.0000
69	P	A	-0.0388
70	G	A	-0.5986
71	V	A	-0.3651
72	S	A	-1.0308
74	D	A	-1.8430
75	R	A	-1.6041
76	F	A	0.0000
77	S	A	-0.9816
78	G	A	-1.1040
79	S	A	-1.3109
80	R	A	-1.5654
83	S	A	-0.8626
84	G	A	-1.1357
85	T	A	-1.1352
86	S	A	-0.8788
87	A	A	0.0000
88	S	A	-0.6901
89	L	A	0.0000
90	T	A	-0.6809
91	I	A	0.0000
92	S	A	-2.1222
93	G	A	-2.2028
94	L	A	0.0000
95	Q	A	-1.8267
96	S	A	-1.3719
97	E	A	-2.2489
98	D	A	0.0000
99	E	A	-1.4415
100	A	A	0.0000
101	D	A	-1.1448
102	Y	A	0.0000
103	Y	A	0.1006
104	A	A	0.0000
105	A	A	0.0000
106	T	A	0.0000
107	W	A	0.5298
108	D	A	0.0000
109	D	A	-1.8828
110	S	A	-0.8207
113	L	A	0.6880
114	N	A	-0.9755
115	G	A	0.1197
116	W	A	1.5523
117	V	A	0.0000
118	F	A	1.6906
119	G	A	0.0000
120	G	A	-0.2968
121	G	A	0.0000
122	T	A	0.0000
123	K	A	-1.8643
124	V	A	0.0000
125	T	A	-0.2491
126	V	A	-0.1982
127	L	A	1.3970