Project name: L14_M

Status: done

Started: 2024-12-06 07:17:50
Settings
Chain sequence(s) A: HRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTE
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:42)
Show buried residues

Minimal score value
-3.7278
Maximal score value
1.404
Average score
-0.7411
Total score value
-168.234

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
43 H A -2.6761
44 R A -3.1761
45 R A -2.5428
46 F A -0.5636
47 E A 0.0000
48 Y A 1.0794
49 K A -0.0574
50 Y A 0.0000
51 S A 0.0000
52 F A 0.0000
53 K A -2.2227
54 G A -2.1945
55 P A -1.8615
56 H A -2.1022
57 L A 0.0000
58 V A -1.2969
59 Q A -1.7791
60 S A -1.6354
61 D A -2.2464
62 G A -1.1954
63 T A -0.5585
64 V A 0.0000
65 P A 0.4657
66 F A 1.2487
67 W A 0.0000
68 A A -0.1826
69 H A -0.3371
70 A A -0.5664
71 G A -1.0879
72 N A -0.7622
73 A A 0.0000
74 I A 1.3018
75 P A 0.1175
76 S A -0.7015
77 S A -1.9227
78 D A -2.6990
79 Q A -1.5084
80 I A 0.0000
81 R A -0.3320
82 V A 0.0000
83 A A 0.0000
84 P A 0.0000
85 S A -0.0284
86 L A 0.4692
87 K A -1.2402
88 S A -1.1323
89 Q A -1.0954
90 R A -1.5280
91 G A 0.0000
92 S A 0.0000
93 V A 0.0000
94 W A 0.0000
95 T A 0.0000
96 K A -1.4819
97 T A -1.2330
98 K A -1.7498
99 A A 0.0000
100 A A -0.8414
101 F A -0.8901
102 E A -2.2912
103 N A 0.0000
104 W A 0.0000
105 E A 0.0000
106 V A 0.0000
107 E A -0.3367
108 V A 0.0000
109 T A -0.4829
110 F A 0.0000
111 R A -0.8667
112 V A 0.0000
113 T A -1.1461
114 G A -1.4993
115 R A -2.3948
116 G A -1.7961
117 R A -1.9483
118 I A -0.0911
119 G A 0.0000
120 A A 0.0000
121 D A -0.6990
122 G A 0.0000
123 L A 0.0000
124 A A 0.0000
125 I A 0.0000
126 W A 0.0000
127 Y A 0.0000
128 A A 0.0000
129 E A -2.2327
130 N A -2.0469
131 Q A -1.4313
132 G A 0.0000
133 L A -0.6083
134 E A -1.9327
135 G A -1.1286
136 P A -0.9305
137 V A 0.0000
138 F A 0.0000
139 G A 0.0000
140 S A 0.0000
141 A A -0.7361
142 D A -0.8011
143 L A -0.3361
144 W A 0.0000
145 N A -1.4675
146 G A 0.0000
147 V A 0.0000
148 G A 0.0000
149 I A 0.0000
150 F A 0.0000
151 F A 0.0000
152 D A 0.0000
153 S A 0.0000
154 F A -0.6095
155 D A -2.4957
156 N A -2.8287
157 D A -2.9293
158 G A -2.7337
159 K A -3.5768
160 K A -3.5395
161 N A -3.2600
162 N A -2.3158
163 P A -1.4872
164 A A 0.0000
165 I A 0.0000
166 V A 0.0000
167 I A 0.0000
168 I A 0.0000
169 G A 0.2644
170 N A 0.0000
171 N A -1.4432
172 G A -1.3661
173 Q A -1.4243
174 I A -0.6036
175 H A -1.0795
176 Y A 0.0000
177 D A -1.8720
178 H A -2.3918
179 Q A -2.7202
180 N A -2.7219
181 D A -2.2058
182 G A 0.0000
183 A A -0.6458
184 S A -0.3973
185 Q A -0.1786
186 A A 0.5348
187 L A 1.0755
188 A A 0.2427
189 S A -0.1359
190 C A -0.6985
191 Q A -1.7175
192 R A -1.7171
193 D A -2.2119
194 F A 0.0000
195 R A 0.0000
196 N A -2.1073
197 K A -0.5611
198 P A 0.0768
199 Y A 0.1768
200 P A -0.1608
201 V A 0.0000
202 R A 0.0000
203 A A 0.0000
204 K A -0.3762
205 I A 0.0000
206 T A -0.3128
207 Y A 0.0000
208 Y A -1.2923
209 Q A -2.5109
210 N A -2.1668
211 T A -1.8330
212 L A 0.0000
213 T A -0.4681
214 V A 0.0000
215 M A -0.1416
216 I A 0.0000
217 N A 0.0000
218 N A -0.5232
219 G A 0.0000
220 F A 1.4040
221 T A -0.5233
222 P A -1.4341
223 D A -3.3013
224 K A -3.6929
225 N A -3.7278
226 D A -3.5759
227 Y A -2.0645
228 E A -1.4201
229 F A 0.8247
230 C A 0.0972
231 A A 0.0000
232 K A -0.9691
233 V A 0.0000
234 E A -2.6502
235 N A -2.2071
236 M A 0.0000
237 I A 1.1685
238 I A 0.1536
239 P A -0.5912
240 A A -0.6680
241 Q A -1.7065
242 G A 0.0000
243 H A 0.0000
244 F A 0.0000
245 G A 0.0000
246 I A 0.0000
247 S A 0.0000
248 A A 0.0000
249 A A 0.0000
250 T A 0.0000
251 G A -0.8222
252 G A -0.7427
253 L A 0.1547
254 A A -0.3143
255 D A 0.0000
256 D A -0.3921
257 H A 0.0000
258 D A 0.0000
259 V A 0.0000
260 L A -1.0539
261 S A 0.0000
262 F A 0.0000
263 L A 0.0685
264 T A 0.0000
265 F A -0.6863
266 Q A -1.4896
267 L A -2.0198
268 T A -2.1601
269 E A -2.5513
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018