Project name: 2e3863c6cac200b

Status: done

Started: 2026-05-29 02:09:57
Settings
Chain sequence(s) A: MKKTAIAIAVALAGFATVAQAAVDNKFNKEAIFASIEIINLPNLNGHQVHAFIRSLSDDPSQSANLLAEAKKLNDAQAPKGQAGQHHHHHHGAYPYDVPDYAS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:59)
Show buried residues

Minimal score value
-3.3013
Maximal score value
3.1783
Average score
-0.7241
Total score value
-74.5799

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -0.1745
2 K A -2.0845
3 K A -2.1509
4 T A -0.7176
5 A A 0.5867
6 I A 2.4078
7 A A 2.2781
8 I A 3.1783
9 A A 2.3776
10 V A 2.7923
11 A A 1.8742
12 L A 2.3621
13 A A 1.3777
14 G A 1.2586
15 F A 2.4581
16 A A 1.3109
17 T A 0.9896
18 V A 1.8483
19 A A 0.6105
20 Q A -0.7871
21 A A -0.6232
22 A A -0.8139
23 V A -0.9642
24 D A -2.2303
25 N A -3.1855
26 K A -3.2751
27 F A -1.7998
28 N A -2.3138
29 K A -1.9800
30 E A -1.7367
31 A A 0.0000
32 I A 1.8277
33 F A 1.8277
34 A A 0.0000
35 S A 1.3706
36 I A 2.2316
37 E A 0.4441
38 I A 0.0000
39 I A 1.2907
40 N A -0.2565
41 L A -0.5636
42 P A -0.8880
43 N A -1.2391
44 L A 0.0000
45 N A -1.7841
46 G A -1.5380
47 H A -1.9108
48 Q A -1.2935
49 V A -0.9032
50 H A -1.6295
51 A A -1.3054
52 F A 0.0000
53 I A -0.4483
54 R A -2.5503
55 S A -1.9232
56 L A 0.0000
57 S A -1.8530
58 D A -2.7966
59 D A -2.1136
60 P A -2.0605
61 S A -1.7478
62 Q A -1.6499
63 S A 0.0000
64 A A -0.9912
65 N A -1.7930
66 L A -1.5110
67 L A -1.0070
68 A A -1.8413
69 E A -3.0054
70 A A 0.0000
71 K A -2.9355
72 K A -3.3013
73 L A -2.0327
74 N A 0.0000
75 D A -3.1644
76 A A -1.8937
77 Q A -1.9528
78 A A -1.8887
79 P A -1.8277
80 K A -2.6996
81 G A -2.0180
82 Q A -2.3428
83 A A -1.8516
84 G A -1.9417
85 Q A -2.4677
86 H A -2.5550
87 H A -2.7369
88 H A -2.7754
89 H A -2.8356
90 H A -2.5062
91 H A -1.8908
92 G A -1.0202
93 A A 0.1944
94 Y A 1.0637
95 P A 0.7222
96 Y A 1.3667
97 D A -0.5517
98 V A 0.6821
99 P A -0.1569
100 D A -1.0200
101 Y A 0.6055
102 A A -0.0454
103 S A -0.0645
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018