Project name: 2eba05c682b10e0

Chain sequence(s)	B: TSTLFRLEFLDSSGNVIDSQTHTILGPAEITNVSISYTSPSTVQVTLTLA
Selected Chain(s)	B
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:11)

• Minimal score value: -2.2585
• Maximal score value: 2.3156
• Average score: 0.2152
• Total score value: 10.7619

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	T	B	0.2621
2	S	B	0.8179
3	T	B	0.8326
4	L	B	1.3489
5	F	B	-0.2798
6	R	B	-2.2309
7	L	B	-1.3356
8	E	B	-1.3069
9	F	B	0.6415
10	L	B	1.3042
11	D	B	-0.0784
12	S	B	-0.4741
13	S	B	-0.7277
14	G	B	-0.4357
15	N	B	-0.4073
16	V	B	1.2735
17	I	B	1.6464
18	D	B	-0.7936
19	S	B	-1.3086
20	Q	B	-2.2585
21	T	B	-1.3557
22	H	B	-0.5868
23	T	B	0.5363
24	I	B	1.2729
25	L	B	1.6666
26	G	B	0.4304
27	P	B	-0.0755
28	A	B	-0.1149
29	E	B	-1.2471
30	I	B	0.5479
31	T	B	0.0552
32	N	B	-0.1261
33	V	B	1.9719
34	S	B	1.2623
35	I	B	2.3156
36	S	B	1.1111
37	Y	B	1.3468
38	T	B	0.4536
39	S	B	0.0043
40	P	B	-0.0772
41	S	B	-0.0986
42	T	B	0.0194
43	V	B	0.7059
44	Q	B	0.0642
45	V	B	1.2978
46	T	B	0.8531
47	L	B	1.1117
48	T	B	0.4540
49	L	B	0.5706
50	A	B	-0.0978