Project name: 2ed85f2f33ca4a5

Chain sequence(s)	A: ETVLTQSPGTLSLSPGERATLSCRASQSLGSSYLAWYQQKPGQAPRLLIYGASSRAPGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYADSPITFGQGTRLEIK
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -3.4712
• Maximal score value: 2.1385
• Average score: -0.6493
• Total score value: -70.1298

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
3	E	A	-1.5832
4	T	A	0.0000
5	V	A	1.0744
6	L	A	0.0000
7	T	A	-0.6035
8	Q	A	0.0000
9	S	A	-1.0345
10	P	A	-0.6981
11	G	A	-1.1842
12	T	A	-1.0042
13	L	A	-0.4088
14	S	A	-0.3536
15	L	A	-0.5143
16	S	A	-1.0481
17	P	A	-1.6633
18	G	A	-2.4110
19	E	A	-2.8201
20	R	A	-3.1095
21	A	A	0.0000
22	T	A	-0.5448
23	L	A	0.0000
24	S	A	-0.9455
25	C	A	0.0000
26	R	A	-2.4369
27	A	A	0.0000
28	S	A	-1.1049
29	Q	A	-1.7878
30	S	A	-1.4239
31	L	A	0.0000
32	G	A	-0.5822
33	S	A	-0.3831
34	S	A	0.2066
35	Y	A	0.7888
36	L	A	0.0000
37	A	A	0.0000
38	W	A	0.0000
39	Y	A	0.1523
40	Q	A	0.0000
41	Q	A	-1.3463
42	K	A	-1.5187
43	P	A	-1.0582
44	G	A	-1.3489
45	Q	A	-2.0009
46	A	A	-1.2690
47	P	A	-1.2882
48	R	A	-1.6545
49	L	A	-0.2629
50	L	A	0.0000
51	I	A	0.0000
52	Y	A	0.7007
53	G	A	0.1909
54	A	A	0.0000
55	S	A	-0.6046
56	S	A	-0.6836
57	R	A	-1.6176
58	A	A	-0.7865
59	P	A	-0.7533
60	G	A	-1.0364
61	I	A	0.0000
62	P	A	-1.4206
63	D	A	-2.4608
64	R	A	-1.9762
65	F	A	0.0000
66	S	A	-1.0192
67	G	A	0.0000
68	S	A	-0.6716
69	G	A	-1.1762
70	S	A	-1.1006
71	G	A	-1.3388
72	T	A	-1.8877
73	D	A	-2.3941
74	F	A	0.0000
75	T	A	-0.8212
76	L	A	0.0000
77	T	A	-0.7919
78	I	A	0.0000
79	S	A	-2.4375
80	R	A	-3.4712
81	L	A	0.0000
82	E	A	-2.0521
83	P	A	-1.0949
84	E	A	-1.7837
85	D	A	0.0000
86	F	A	-0.4812
87	A	A	0.0000
88	V	A	-0.7039
89	Y	A	0.0000
90	Y	A	0.0951
91	C	A	0.0000
92	Q	A	0.0000
93	Q	A	0.0000
94	Y	A	1.1280
95	A	A	0.0191
96	D	A	-1.2057
97	S	A	-0.6578
98	P	A	0.2419
99	I	A	1.9158
100	T	A	0.0000
101	F	A	2.1385
102	G	A	0.0000
103	Q	A	-0.8193
104	G	A	0.0000
105	T	A	0.0000
106	R	A	-1.9935
107	L	A	0.0000
108	E	A	-0.2652
109	I	A	0.9544
110	K	A	-0.8363