Project name: IL6_Nanobody

Chain sequence(s)	A: QVQLVESGGGLVQPGGSLRLSCAASNRPLHPSEQGGWFRQAPGQGLEAVAGTDPMANQAARDRDGTGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAIGPMVITQEELDYYRSTAGQGTLVTVS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:19)

• Minimal score value: -3.7963
• Maximal score value: 1.8477
• Average score: -0.6935
• Total score value: -86.6899

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.5148
2	V	A	-0.9014
3	Q	A	-0.2727
4	L	A	0.0000
5	V	A	1.2703
6	E	A	0.4263
7	S	A	-0.2825
8	G	A	-0.8795
9	G	A	0.0806
10	G	A	0.6427
11	L	A	1.3497
12	V	A	0.0000
13	Q	A	-1.4148
14	P	A	-1.6104
15	G	A	-1.4127
16	G	A	-0.9656
17	S	A	-1.2403
18	L	A	-0.9112
19	R	A	-2.1434
20	L	A	0.0000
21	S	A	-0.5132
22	C	A	0.0000
23	A	A	-0.0069
24	A	A	-0.1258
25	S	A	-0.7325
26	N	A	-1.2223
27	R	A	-1.8390
28	P	A	-0.6359
29	L	A	-0.0267
30	H	A	0.0000
31	P	A	-0.4052
32	S	A	-0.1468
33	E	A	-0.1313
34	Q	A	-0.4624
35	G	A	0.0000
36	G	A	0.0000
37	W	A	0.0000
38	F	A	0.0755
39	R	A	-0.0008
40	Q	A	-0.4785
41	A	A	-0.8148
42	P	A	-0.9091
43	G	A	-1.2872
44	Q	A	-1.6305
45	G	A	-0.9753
46	L	A	0.0785
47	E	A	-0.5490
48	A	A	-0.3908
49	V	A	0.0000
50	A	A	-0.8885
51	G	A	-0.8309
52	T	A	0.0000
53	D	A	-0.7281
54	P	A	-0.1285
55	M	A	0.3733
56	A	A	-0.4994
57	N	A	-1.4696
58	Q	A	-1.4235
59	A	A	-1.2424
60	A	A	-1.8423
61	R	A	-3.1927
62	D	A	-3.7963
63	R	A	-3.6313
64	D	A	-3.1506
65	G	A	-2.4132
66	T	A	-2.2092
67	G	A	-1.5362
68	R	A	-1.1615
69	F	A	0.0000
70	T	A	-0.7505
71	I	A	0.0000
72	S	A	-0.8443
73	R	A	-1.2880
74	D	A	-2.0774
75	N	A	-2.2361
76	S	A	-1.9435
77	K	A	-2.5253
78	N	A	-1.5624
79	T	A	0.0000
80	L	A	0.0000
81	Y	A	-0.7082
82	L	A	0.0000
83	Q	A	-1.3025
84	M	A	0.0000
85	N	A	-1.3800
86	S	A	-1.2958
87	L	A	0.0000
88	R	A	-2.2484
89	A	A	-1.5676
90	E	A	-2.0040
91	D	A	0.0000
92	T	A	-0.2961
93	A	A	0.0000
94	V	A	0.9313
95	Y	A	0.0000
96	Y	A	0.0922
97	C	A	0.0000
98	A	A	0.0000
99	I	A	0.0000
100	G	A	0.0000
101	P	A	-0.3151
102	M	A	0.3460
103	V	A	0.6262
104	I	A	1.8477
105	T	A	0.1076
106	Q	A	-1.4738
107	E	A	-2.4979
108	E	A	-2.6064
109	L	A	-1.4508
110	D	A	-0.9822
111	Y	A	-0.3981
112	Y	A	-0.6521
113	R	A	-1.9636
114	S	A	-1.3565
115	T	A	-1.0159
116	A	A	0.0000
117	G	A	0.0000
118	Q	A	-1.1712
119	G	A	-0.1439
120	T	A	0.6269
121	L	A	1.7467
122	V	A	0.0000
123	T	A	0.4071
124	V	A	0.0000
125	S	A	-0.6834