Project name: query_structure

Chain sequence(s)	A: EGCVYLPCFTAPLGCSCSSKVCYRNGIPCG
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:11)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:12)

• Minimal score value: -1.4832
• Maximal score value: 2.3597
• Average score: 0.3461
• Total score value: 10.3821

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-0.2887
2	G	A	0.0371
3	C	A	0.9557
4	V	A	1.2769
5	Y	A	2.1120
6	L	A	2.3597
7	P	A	1.3593
8	C	A	0.0000
9	F	A	2.1003
10	T	A	1.1279
11	A	A	0.8555
12	P	A	0.7525
13	L	A	1.3491
14	G	A	0.0003
15	C	A	0.0000
16	S	A	-0.0178
17	C	A	0.3056
18	S	A	-0.3025
19	S	A	-0.5891
20	K	A	-0.8583
21	V	A	-0.0284
22	C	A	0.0000
23	Y	A	-0.1660
24	R	A	-1.0365
25	N	A	-1.4832
26	G	A	-0.4373
27	I	A	1.0252
28	P	A	0.2346
29	C	A	0.1812
30	G	A	-0.4430