Project name: query_structure

Status: done

Started: 2026-03-16 20:40:01
Settings
Chain sequence(s) A: MAASSVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGGGWYGQEFEVPGSKSTATISGLKPGVDYTITVYAYEFYSGEYSHFSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:42)
Show buried residues

Minimal score value
-2.574
Maximal score value
1.9539
Average score
-0.4516
Total score value
-43.3559

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.0721
2 A A 0.5285
3 A A 0.4347
4 S A 0.2499
5 S A 0.1368
6 V A 0.1574
7 P A 0.0000
8 T A -1.2106
9 K A -2.3395
10 L A 0.0000
11 E A -1.7980
12 V A 0.0963
13 V A 1.5155
14 A A 0.8730
15 A A 0.2796
16 T A -0.5463
17 P A -1.1414
18 T A -1.0173
19 S A -0.5576
20 L A 0.0000
21 L A 0.6959
22 I A 0.0000
23 S A -0.7684
24 W A 0.0000
25 D A -1.6649
26 A A -0.7290
27 P A 0.0000
28 A A 0.2226
29 V A 0.4152
30 T A 0.4224
31 V A 0.0643
32 D A -0.4767
33 H A -1.1215
34 Y A 0.0000
35 V A 0.0000
36 I A 0.0000
37 T A -1.1235
38 Y A 0.0000
39 G A -0.8583
40 E A -1.4953
41 T A -1.2662
42 G A -0.9221
43 G A -0.5830
44 G A -0.0675
45 W A 0.9722
46 Y A 0.9902
47 G A -0.3971
48 Q A -1.6430
49 E A -2.3380
50 F A -1.5780
51 E A -1.9938
52 V A 0.0000
53 P A -1.5476
54 G A -1.4961
55 S A -1.3701
56 K A -2.0149
57 S A -1.2196
58 T A -0.6510
59 A A 0.0000
60 T A 0.2728
61 I A 0.0000
62 S A -0.6689
63 G A -1.1516
64 L A 0.0000
65 K A -2.3846
66 P A -1.6579
67 G A -1.4452
68 V A -1.4412
69 D A -2.1459
70 Y A 0.0000
71 T A -1.0774
72 I A 0.0000
73 T A -0.2820
74 V A 0.0000
75 Y A -0.1966
76 A A 0.0000
77 Y A 0.1625
78 E A 0.0000
79 F A 1.9539
80 Y A 1.5586
81 S A 0.2516
82 G A -0.3450
83 E A -0.6247
84 Y A 0.9937
85 S A 0.2374
86 H A -0.3877
87 F A 0.0222
88 S A -0.1533
89 P A 0.0354
90 I A 0.1905
91 S A -0.2990
92 I A -0.4721
93 N A -1.7509
94 Y A -1.5087
95 R A -2.5740
96 T A -1.6581
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018