Project name: query_structure

Status: done

Started: 2026-03-17 01:10:21
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVDFYYITYGETGSSYWSYQEFTVPGSKSTATISGLKPGVDYTITVYAIDQWQYYYYEMGSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:40)
Show buried residues

Minimal score value
-3.0567
Maximal score value
2.7703
Average score
-0.332
Total score value
-31.8675

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.6718
2 S A 0.3618
3 D A -0.1430
4 V A -0.2982
5 P A 0.0000
6 R A -2.6972
7 D A -3.0567
8 L A 0.0000
9 E A -1.9949
10 V A 0.1123
11 V A 1.5585
12 A A 0.9084
13 A A 0.3199
14 T A -0.3340
15 P A -1.1138
16 T A -0.9960
17 S A -0.5212
18 L A 0.0000
19 L A 0.7837
20 I A 0.0000
21 S A -0.9374
22 W A 0.0000
23 D A -2.3003
24 A A -1.1666
25 P A 0.0000
26 A A 0.3414
27 V A 0.5156
28 T A -0.2999
29 V A -0.6559
30 D A -1.3027
31 F A -0.6826
32 Y A 0.0000
33 Y A 0.0008
34 I A 0.0000
35 T A 0.0000
36 Y A -0.7400
37 G A 0.0000
38 E A -1.4997
39 T A -1.0380
40 G A -0.6781
41 S A -0.1458
42 S A 0.5693
43 Y A 1.4708
44 W A 1.5201
45 S A 0.2736
46 Y A -0.2890
47 Q A -1.5839
48 E A -2.0391
49 F A -0.5548
50 T A -0.0547
51 V A 0.0000
52 P A -0.9584
53 G A -1.1428
54 S A -1.2573
55 K A -1.9798
56 S A -1.1617
57 T A -0.6205
58 A A 0.0000
59 T A 0.0713
60 I A 0.0000
61 S A -0.6542
62 G A -1.0289
63 L A 0.0000
64 K A -2.3840
65 P A -1.6610
66 G A -1.4544
67 V A -1.4563
68 D A -2.1069
69 Y A 0.0000
70 T A -0.9854
71 I A 0.0000
72 T A 0.0000
73 V A 0.0000
74 Y A 0.2871
75 A A 0.0000
76 I A 0.0000
77 D A -0.3226
78 Q A 0.3687
79 W A 1.6648
80 Q A 1.2669
81 Y A 2.2299
82 Y A 2.7703
83 Y A 2.5644
84 Y A 2.0425
85 E A 0.0840
86 M A 0.2222
87 G A 0.0000
88 S A -0.3549
89 P A -0.1060
90 I A -0.1829
91 S A -0.6671
92 I A -0.7271
93 N A -1.7674
94 Y A -1.5331
95 R A -2.5667
96 T A -1.6447
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018