Project name: obj1 [mutate: VA5C, GN10C, GE15C, LI20C, FS27C, SK35C, PQ41C, AR50C, GS53C, AV61C, DT73C, NW77C, MV83C, AH92C, DC101C, DL108C, TK114C, SP119C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	AH92C,LI20C,MV83C,GS53C,FS27C,AR50C,DT73C,NW77C,AV61C,DL108C,VA5C,SP119C,SK35C,TK114C,GN10C,DC101C,GE15C,PQ41C
Energy difference between WT (input) and mutated protein (by FoldX)	43.6339 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:25)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:04:46)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:18)

• Minimal score value: -2.739
• Maximal score value: 1.1248
• Average score: -0.6655
• Total score value: -79.8627

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-1.8886
2	V	C	-1.1040
3	Q	C	-1.5377
4	L	C	0.0000
5	A	C	-0.5923	mutated: VA5C
6	E	C	0.0000
7	S	C	-0.7976
8	G	C	-1.0234
9	G	C	-0.5092
10	N	C	-0.2100	mutated: GN10C
11	L	C	0.9398
12	V	C	-0.4699
13	Q	C	-1.6048
14	P	C	-2.0272
15	E	C	-2.7075	mutated: GE15C
16	G	C	-1.6006
17	S	C	-1.5232
18	L	C	-1.0761
19	R	C	-2.1244
20	I	C	0.0000	mutated: LI20C
21	S	C	-0.7502
22	C	C	0.0000
23	A	C	-0.3556
24	A	C	0.0000
25	S	C	-0.7191
26	D	C	0.0000
27	S	C	-0.4886	mutated: FS27C
28	T	C	-0.6692
29	F	C	0.0000
30	R	C	-2.0181
31	S	C	-1.0661
32	Y	C	-0.6533
33	E	C	-0.6549
34	M	C	0.0000
35	K	C	0.0000	mutated: SK35C
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.3967
40	A	C	-1.3896
41	Q	C	-2.2367	mutated: PQ41C
42	G	C	-1.8992
43	K	C	-2.3774
44	G	C	-1.1266
45	L	C	0.6308
46	E	C	0.2265
47	W	C	0.9043
48	V	C	0.0000
49	S	C	0.0000
50	R	C	0.0684	mutated: AR50C
51	I	C	0.0000
52	S	C	-0.6222
53	S	C	-1.0659	mutated: GS53C
54	S	C	-1.0695
55	G	C	-0.9646
56	G	C	-0.7119
57	S	C	-0.3701
58	T	C	-0.0294
59	Y	C	0.1306
60	Y	C	-0.5461
61	V	C	0.0000	mutated: AV61C
62	D	C	-2.3907
63	S	C	-1.7185
64	V	C	0.0000
65	K	C	-2.4411
66	G	C	-1.6155
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.7640
70	I	C	0.0000
71	S	C	-0.4860
72	R	C	-0.9028
73	T	C	-1.0647	mutated: DT73C
74	N	C	-1.4930
75	S	C	-1.3048
76	K	C	-1.6916
77	W	C	-0.9184	mutated: NW77C
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	0.0000
81	L	C	0.0000
82	Q	C	-1.2704
83	V	C	0.0000	mutated: MV83C
84	N	C	-1.6021
85	S	C	-1.7786
86	L	C	0.0000
87	R	C	-2.7390
88	A	C	-2.0053
89	E	C	-2.4467
90	D	C	0.0000
91	T	C	-0.7235
92	H	C	0.0000	mutated: AH92C
93	I	C	0.5725
94	Y	C	0.0000
95	Y	C	0.3859
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-1.5588
101	C	C	-0.6719	mutated: DC101C
102	G	C	-0.9268
103	F	C	-0.9448
104	N	C	-2.0814
105	K	C	-2.3955
106	G	C	-1.2437
107	F	C	-0.0220
108	L	C	0.5073	mutated: DL108C
109	Y	C	0.3627
110	W	C	0.6594
111	G	C	-0.5135
112	Q	C	-1.2756
113	G	C	-0.3692
114	K	C	-0.3808	mutated: TK114C
115	L	C	1.1248
116	V	C	0.0000
117	T	C	0.0609
118	V	C	0.0000
119	P	C	-0.7045	mutated: SP119C
120	S	C	-1.0139