Project name: 2fbc81bb59feb04

Status: done

Started: 2026-06-22 16:05:59
Settings
Chain sequence(s) B: MAFKDELMARLKALKAVLAKLEEQLSPEQAKKAKAAFEKIEAKVKELMAT
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:54)
Show buried residues

Minimal score value
-3.8588
Maximal score value
1.0467
Average score
-1.7104
Total score value
-85.5218

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 0.8659
2 A B 0.3770
3 F B 1.0467
4 K B -0.7098
5 D B -1.8910
6 E B -1.9145
7 L B -1.3641
8 M B -1.6475
9 A B -2.0494
10 R B -2.8141
11 L B 0.0000
12 K B -2.3749
13 A B -1.1085
14 L B -0.6338
15 K B -2.0143
16 A B -0.8799
17 V B 0.1010
18 L B 0.0000
19 A B -1.4792
20 K B -2.1543
21 L B -1.5886
22 E B -3.2673
23 E B -3.0828
24 Q B -2.5485
25 L B -1.9957
26 S B -2.0152
27 P B -2.6566
28 E B -3.4742
29 Q B -3.2210
30 A B 0.0000
31 K B -3.8588
32 K B -3.8181
33 A B -2.4711
34 K B -3.0179
35 A B -2.3625
36 A B -1.7909
37 F B 0.0000
38 E B -3.1544
39 K B -2.7837
40 I B -1.4938
41 E B -2.3283
42 A B -2.4014
43 K B -2.6073
44 V B -1.6726
45 K B -2.4660
46 E B -2.3682
47 L B -0.6418
48 M B -0.6787
49 A B -0.8322
50 T B -0.2795
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018