Project name: query_structure

Status: done

Started: 2026-03-16 23:56:33
Settings
Chain sequence(s) A: MADVQLVESGGGLVQAGGSLRLSCTASGLTISTYNIGWFRQAPGKEREFVGIIIRNGDTTYYADSVKGRFTISRDNAKNTVYLQMNSVKPADAAVYSCGATVRAGAAAEQYNSYIFRGQGTQVTV
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:59)
Show buried residues

Minimal score value
-3.5293
Maximal score value
1.856
Average score
-0.7637
Total score value
-95.4686

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.6522
2 A A -0.4308
3 D A -1.6391
4 V A -0.8227
5 Q A -1.4608
6 L A 0.0000
7 V A 0.3265
8 E A 0.0000
9 S A -0.5486
10 G A -0.9974
11 G A -0.7892
12 G A 0.0833
13 L A 1.1844
14 V A 0.0000
15 Q A -1.0275
16 A A -1.0121
17 G A -1.2785
18 G A -1.0064
19 S A -1.3013
20 L A -1.0247
21 R A -2.1172
22 L A 0.0000
23 S A -0.4731
24 C A 0.0000
25 T A -0.2832
26 A A 0.0000
27 S A -0.6728
28 G A -0.6999
29 L A -0.3135
30 T A -0.4781
31 I A 0.0000
32 S A -1.3140
33 T A -0.4035
34 Y A 0.1035
35 N A 0.0000
36 I A 0.0000
37 G A 0.0000
38 W A 0.0000
39 F A 0.0000
40 R A -1.3532
41 Q A -2.2260
42 A A -1.7686
43 P A -1.4273
44 G A -1.9897
45 K A -3.3764
46 E A -3.5293
47 R A -2.5774
48 E A -2.0337
49 F A -1.2000
50 V A 0.0000
51 G A 0.0000
52 I A 0.0000
53 I A 0.0000
54 I A -1.1055
55 R A -2.2045
56 N A -2.6785
57 G A -2.2957
58 D A -2.4878
59 T A -1.1816
60 T A -0.1462
61 Y A 0.4547
62 Y A -0.4287
63 A A -1.1873
64 D A -2.3299
65 S A -1.5888
66 V A 0.0000
67 K A -2.4985
68 G A -1.7654
69 R A -1.4711
70 F A 0.0000
71 T A -0.7397
72 I A 0.0000
73 S A -0.7395
74 R A -1.5206
75 D A -1.9486
76 N A -2.4845
77 A A -1.7143
78 K A -2.4435
79 N A -1.8291
80 T A 0.0000
81 V A 0.0000
82 Y A -0.6506
83 L A 0.0000
84 Q A -1.1879
85 M A 0.0000
86 N A -1.4013
87 S A -1.2644
88 V A 0.0000
89 K A -1.6111
90 P A -0.8098
91 A A -0.3779
92 D A 0.0000
93 A A -0.1622
94 A A 0.0000
95 V A -0.5599
96 Y A 0.0000
97 S A -0.7901
98 C A 0.0000
99 G A 0.0000
100 A A 0.0000
101 T A 0.0000
102 V A 1.1048
103 R A -0.9448
104 A A -0.7219
105 G A -0.7684
106 A A -0.6184
107 A A -1.2413
108 A A 0.0000
109 E A -2.4480
110 Q A -2.1349
111 Y A -1.0119
112 N A -1.2218
113 S A -0.5379
114 Y A 0.4668
115 I A 1.8560
116 F A 0.5576
117 R A -1.3537
118 G A 0.0000
119 Q A -1.5308
120 G A 0.0000
121 T A 0.0000
122 Q A -1.1405
123 V A 0.0000
124 T A 0.2686
125 V A 0.3278
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018