Project name: 75-1

Status: done

Started: 2026-03-11 14:07:20
Settings
Chain sequence(s) A: SPIYEFVKKEMLEYYEKHGVDKEKIEEVINFAAEHPDDPDEISFKIWDFAGEENSMEAMLFAAKVSDKIFEIAES
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:06)
Show buried residues

Minimal score value
-4.1246
Maximal score value
0.6709
Average score
-1.5838
Total score value
-118.782

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S A -0.9423
2 P A -0.9761
3 I A 0.0000
4 Y A -1.8181
5 E A -2.3000
6 F A -1.6387
7 V A 0.0000
8 K A -2.8407
9 K A -3.1025
10 E A -2.5074
11 M A 0.0000
12 L A -2.4255
13 E A -3.5256
14 Y A 0.0000
15 Y A -2.5963
16 E A -3.4045
17 K A -3.1944
18 H A -2.4500
19 G A -2.1238
20 V A -2.0892
21 D A -3.2110
22 K A -3.7157
23 E A -4.1246
24 K A -3.6446
25 I A 0.0000
26 E A -3.7740
27 E A -3.6706
28 V A 0.0000
29 I A 0.0000
30 N A -2.6611
31 F A -1.8771
32 A A 0.0000
33 A A -2.0472
34 E A -2.5214
35 H A -2.4706
36 P A -2.2558
37 D A -2.9274
38 D A -2.8479
39 P A -1.7126
40 D A -2.0334
41 E A -1.6065
42 I A 0.0000
43 S A 0.0000
44 F A 0.6709
45 K A -0.5968
46 I A 0.0000
47 W A -0.1196
48 D A -1.8846
49 F A 0.0000
50 A A 0.0000
51 G A -2.1222
52 E A -3.0840
53 E A -2.4901
54 N A -2.4406
55 S A -0.9743
56 M A 0.2070
57 E A -1.1155
58 A A 0.0000
59 M A -0.1741
60 L A 0.5405
61 F A -0.2959
62 A A 0.0000
63 A A -0.8231
64 K A -2.1372
65 V A 0.0000
66 S A 0.0000
67 D A -2.9261
68 K A -2.6473
69 I A 0.0000
70 F A -1.6280
71 E A -2.7321
72 I A -1.4254
73 A A -1.9022
74 E A -2.2910
75 S A -1.3537
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018