Project name: query_structure

Status: done

Started: 2026-03-16 20:07:42
Settings
Chain sequence(s) A: EAMHSFCAFKAETGPCRARFDRWFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:37)
Show buried residues

Minimal score value
-3.3657
Maximal score value
1.6336
Average score
-1.3003
Total score value
-78.0155

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.9463
2 A A -0.9427
3 M A -0.5257
4 H A -0.4304
5 S A 0.1314
6 F A 0.3483
7 C A 0.0000
8 A A 0.5652
9 F A 0.1846
10 K A -1.4514
11 A A 0.0000
12 E A -2.0830
13 T A -1.4882
14 G A -1.4136
15 P A -1.1053
16 C A -1.2529
17 R A -2.0384
18 A A -1.6228
19 R A -2.1248
20 F A -1.2159
21 D A -2.4744
22 R A -2.1079
23 W A -2.0392
24 F A -1.3415
25 F A 0.0000
26 N A -0.3989
27 I A 0.9484
28 F A 1.6336
29 T A -0.1623
30 R A -1.4916
31 Q A -2.0080
32 C A -1.9453
33 E A -1.7404
34 E A -2.5359
35 F A -1.3338
36 I A -1.0914
37 Y A 0.0000
38 G A 0.0000
39 G A -1.0692
40 C A -1.0530
41 E A -2.1967
42 G A -2.1801
43 N A -1.5846
44 Q A -1.6810
45 N A 0.0000
46 R A -1.9580
47 F A 0.0000
48 E A -2.7695
49 S A -2.5297
50 L A -2.1554
51 E A -3.2041
52 E A -3.0589
53 C A 0.0000
54 K A -3.3657
55 K A -3.3229
56 M A -1.5335
57 C A 0.0000
58 T A -2.5842
59 R A -2.6509
60 D A -2.6176
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018