Project name: 316343988506b6e

Chain sequence(s)	A: MAEVQLQASGGGFVQPGGSLRLSCAASGTTSFGDTMGWYRNAPGKKREDVSAISRQGDDSHHYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAPYYCSEWMFTRREFITLYGGQGTHVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:23)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:24)

• Minimal score value: -4.0311
• Maximal score value: 1.6291
• Average score: -0.9961
• Total score value: -123.5188

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.5113
2	A	A	-0.6300
3	E	A	-1.8964
4	V	A	-1.3727
5	Q	A	-2.1583
6	L	A	0.0000
7	Q	A	-1.9283
8	A	A	-1.3114
9	S	A	-1.1867
10	G	A	-1.1391
11	G	A	-0.7561
12	G	A	0.1828
13	F	A	1.3558
14	V	A	0.0000
15	Q	A	-1.3287
16	P	A	-1.6431
17	G	A	-1.4341
18	G	A	-0.9354
19	S	A	-1.0639
20	L	A	-0.9854
21	R	A	-2.1115
22	L	A	0.0000
23	S	A	-0.7981
24	C	A	0.0000
25	A	A	-1.1026
26	A	A	-1.1643
27	S	A	-1.5114
28	G	A	-1.1858
29	T	A	-0.6008
30	T	A	-0.3005
31	S	A	-0.2011
32	F	A	-0.4733
33	G	A	0.0000
34	D	A	-0.3956
35	T	A	-0.2917
36	M	A	0.0000
37	G	A	0.0000
38	W	A	0.0000
39	Y	A	0.0000
40	R	A	0.0000
41	N	A	-2.6890
42	A	A	-2.2625
43	P	A	-1.7259
44	G	A	-2.1219
45	K	A	-3.5450
46	K	A	-4.0311
47	R	A	-3.9419
48	E	A	-3.0452
49	D	A	-2.9018
50	V	A	0.0000
51	S	A	0.0000
52	A	A	-0.6890
53	I	A	0.0000
54	S	A	-1.9082
55	R	A	-2.4289
56	Q	A	-2.5132
57	G	A	-2.6698
58	D	A	-3.3828
59	D	A	-3.3164
60	S	A	-2.2701
61	H	A	-1.7126
62	H	A	-1.9050
63	Y	A	-1.6937
64	A	A	-2.0437
65	D	A	-2.7563
66	S	A	-1.9615
67	V	A	0.0000
68	K	A	-2.7085
69	G	A	-1.7072
70	R	A	-1.4012
71	F	A	0.0000
72	T	A	-0.9428
73	I	A	0.0000
74	S	A	-0.7871
75	R	A	-1.5420
76	D	A	-1.8681
77	N	A	-2.0113
78	S	A	-1.7153
79	K	A	-2.4486
80	N	A	-1.8003
81	T	A	0.0000
82	V	A	0.0000
83	Y	A	-0.6280
84	L	A	0.0000
85	Q	A	-1.2238
86	M	A	0.0000
87	N	A	-1.3753
88	S	A	-1.2475
89	L	A	0.0000
90	R	A	-2.4372
91	A	A	-1.8062
92	E	A	-2.2840
93	D	A	0.0000
94	T	A	-0.9577
95	A	A	0.0000
96	P	A	-0.9055
97	Y	A	0.0000
98	Y	A	-0.5609
99	C	A	0.0000
100	S	A	0.0000
101	E	A	0.0000
102	W	A	1.4320
103	M	A	0.0000
104	F	A	1.5734
105	T	A	-0.3507
106	R	A	-2.3991
107	R	A	-2.7166
108	E	A	-1.3633
109	F	A	1.5792
110	I	A	1.6291
111	T	A	1.3970
112	L	A	0.8576
113	Y	A	0.9556
114	G	A	-0.4484
115	G	A	-1.2882
116	Q	A	-1.8480
117	G	A	-1.2614
118	T	A	-1.2023
119	H	A	-1.0337
120	V	A	0.0000
121	T	A	-0.2270
122	V	A	0.0000
123	S	A	-0.6254
124	S	A	-0.4482