Project name: 31848b0217f7c62

Status: done

Started: 2026-07-08 16:38:39
Settings
Chain sequence(s) A: AEVRALVAELEATRARTDALIAAALPHLPADLRARFQAAYDAGVARADELAALVAAERWDEALALIEQLLADMETTSRPLVAAVVAALRAAGHDALADELEATFARNVELGRQLLAALRA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:33)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:33)
Show buried residues

Minimal score value
-3.5437
Maximal score value
0.0
Average score
-1.261
Total score value
-151.3207

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A -1.0579
2 E A -1.9888
3 V A -1.2555
4 R A -1.5452
5 A A -1.4410
6 L A -1.3653
7 V A -1.3583
8 A A -1.5735
9 E A -2.3626
10 L A 0.0000
11 E A -2.3083
12 A A -1.6356
13 T A 0.0000
14 R A -1.8515
15 A A -1.7710
16 R A -2.5839
17 T A 0.0000
18 D A -2.3007
19 A A -1.2353
20 L A -0.9854
21 I A 0.0000
22 A A -0.3758
23 A A -0.1381
24 A A 0.0000
25 L A -0.2738
26 P A -0.4770
27 H A -0.7708
28 L A 0.0000
29 P A -0.9039
30 A A -1.3544
31 D A -2.3602
32 L A -1.6313
33 R A -1.8285
34 A A -1.8055
35 R A -2.4543
36 F A 0.0000
37 Q A -1.5199
38 A A -1.3427
39 A A -1.0216
40 Y A -1.1591
41 D A -1.9059
42 A A -0.9772
43 G A -1.2196
44 V A -1.5406
45 A A -1.6790
46 R A -2.3074
47 A A 0.0000
48 D A -2.9716
49 E A -2.9669
50 L A 0.0000
51 A A -1.6895
52 A A -1.5406
53 L A 0.0000
54 V A 0.0000
55 A A -0.9944
56 A A -1.1622
57 E A -2.6577
58 R A -2.7812
59 W A -2.0111
60 D A -2.7021
61 E A -2.5057
62 A A 0.0000
63 L A -1.3984
64 A A -1.1916
65 L A -1.4672
66 I A 0.0000
67 E A -2.4125
68 Q A -2.1222
69 L A 0.0000
70 L A 0.0000
71 A A -1.1882
72 D A -1.3245
73 M A -0.9078
74 E A -1.2959
75 T A -0.8554
76 T A -0.9367
77 S A -1.0919
78 R A -1.8139
79 P A -0.9091
80 L A -0.7960
81 V A 0.0000
82 A A -0.5575
83 A A -0.1751
84 V A 0.0000
85 V A 0.0000
86 A A -0.5089
87 A A -0.6052
88 L A 0.0000
89 R A -2.0193
90 A A -0.8935
91 A A -0.9199
92 G A -1.4521
93 H A -1.8800
94 D A -2.9889
95 A A -2.0260
96 L A -1.9481
97 A A 0.0000
98 D A -3.5437
99 E A -3.3565
100 L A 0.0000
101 E A -2.8924
102 A A -2.0486
103 T A 0.0000
104 F A -1.4988
105 A A -1.7976
106 R A -2.6524
107 N A 0.0000
108 V A 0.0000
109 E A -3.1408
110 L A 0.0000
111 G A 0.0000
112 R A -3.1410
113 Q A -2.3547
114 L A 0.0000
115 L A -1.5050
116 A A -1.0973
117 A A -1.2268
118 L A -1.1665
119 R A -1.8259
120 A A -0.7375
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018