Project name: Mb5-11_FVVLLL

Chain sequence(s)	A: MQANSGSLEVVEASPTSLQFSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATVSGLKPGVDYTLTVYAVTWYPRYGYGESGPLSLNYRTELDKPSQ
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:02)

• Minimal score value: -2.7768
• Maximal score value: 1.452
• Average score: -0.6923
• Total score value: -75.4661

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.4094
2	Q	A	-0.8568
3	A	A	-0.7733
4	N	A	-1.3900
5	S	A	-0.9592
6	G	A	0.0000
7	S	A	-1.0755
8	L	A	-1.0154
9	E	A	-1.7464
10	V	A	-0.5584
11	V	A	0.3518
12	E	A	-1.3004
13	A	A	-1.0991
14	S	A	-1.4490
15	P	A	-1.7738
16	T	A	-1.1544
17	S	A	-1.1157
18	L	A	0.0000
19	Q	A	-0.8487
20	F	A	0.0000
21	S	A	-0.9512
22	W	A	0.0000
23	D	A	-1.9041
24	A	A	-1.2887
25	F	A	0.0000
26	H	A	-1.0709
27	R	A	-0.1707
28	Y	A	0.8830
29	H	A	0.1114
30	N	A	-0.6528
31	G	A	0.0824
32	F	A	1.4520
33	T	A	0.7260
34	H	A	0.0000
35	P	A	-0.4129
36	V	A	-1.0342
37	R	A	-1.3962
38	Y	A	-0.8836
39	Y	A	0.0000
40	R	A	-0.8309
41	V	A	0.0000
42	T	A	0.0000
43	Y	A	-0.3486
44	G	A	-0.6271
45	E	A	-1.2820
46	T	A	-1.0577
47	G	A	-1.1368
48	G	A	-1.2524
49	N	A	-1.4787
50	S	A	-0.8471
51	P	A	-0.3658
52	V	A	0.3385
53	Q	A	-1.1956
54	E	A	-1.8116
55	F	A	-0.6782
56	T	A	-0.1781
57	V	A	-0.4002
58	P	A	-0.9246
59	G	A	-1.2176
60	S	A	-1.2025
61	K	A	-1.6078
62	S	A	-1.0727
63	T	A	-0.7237
64	A	A	0.0000
65	T	A	-0.3486
66	V	A	0.0000
67	S	A	-0.7656
68	G	A	-0.9747
69	L	A	0.0000
70	K	A	-2.3279
71	P	A	-2.0111
72	G	A	-1.3102
73	V	A	-1.0763
74	D	A	-1.9945
75	Y	A	0.0000
76	T	A	-0.7322
77	L	A	0.0000
78	T	A	0.0000
79	V	A	0.0000
80	Y	A	-0.3104
81	A	A	0.0000
82	V	A	0.0000
83	T	A	0.0000
84	W	A	0.6053
85	Y	A	0.0000
86	P	A	-0.4256
87	R	A	-1.0938
88	Y	A	0.7316
89	G	A	0.7350
90	Y	A	1.1186
91	G	A	0.3101
92	E	A	-0.7855
93	S	A	0.0000
94	G	A	-0.7081
95	P	A	-0.4385
96	L	A	-0.3129
97	S	A	-0.4987
98	L	A	-0.6696
99	N	A	-1.7166
100	Y	A	-1.5101
101	R	A	-2.4152
102	T	A	0.0000
103	E	A	-1.9255
104	L	A	-1.2337
105	D	A	-2.6982
106	K	A	-2.7768
107	P	A	-1.8295
108	S	A	-1.6439
109	Q	A	-1.6664