Project name: 329a4e705f9feb3

Chain sequence(s)	A: EAKLTNTTTESRCPTQGEPTLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFTCK
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:32)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:32)

• Minimal score value: -2.7925
• Maximal score value: 2.1061
• Average score: -0.783
• Total score value: -47.7605

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-2.2743
2	A	A	-1.0564
3	K	A	-1.4094
4	L	A	0.3774
5	T	A	-0.1249
6	N	A	-0.8848
7	T	A	-0.0871
8	T	A	-0.6359
9	T	A	-0.7169
10	E	A	-1.2598
11	S	A	-1.0121
12	R	A	-1.6325
13	C	A	-1.0634
14	P	A	-0.7793
15	T	A	-1.1672
16	Q	A	-2.0083
17	G	A	-2.0860
18	E	A	-2.5284
19	P	A	0.0000
20	T	A	-1.2898
21	L	A	-1.2275
22	N	A	-1.9957
23	E	A	-1.9416
24	E	A	-2.3551
25	Q	A	-2.6189
26	D	A	-2.5661
27	K	A	-2.7925
28	R	A	-2.1439
29	F	A	-0.7635
30	V	A	0.8266
31	C	A	-0.7322
32	K	A	-1.7434
33	H	A	-1.8569
34	S	A	-0.6697
35	M	A	0.0130
36	V	A	-0.3594
37	D	A	-1.7829
38	R	A	0.0000
39	G	A	0.0000
40	W	A	0.9498
41	G	A	-0.6618
42	N	A	-1.4273
43	G	A	-0.7777
44	C	A	0.0000
45	G	A	0.6731
46	L	A	2.1061
47	F	A	1.8304
48	G	A	-0.1161
49	K	A	-1.4801
50	G	A	0.0000
51	G	A	0.0000
52	I	A	-0.9196
53	V	A	0.0000
54	T	A	-0.7235
55	C	A	0.0000
56	A	A	0.3491
57	M	A	0.3083
58	F	A	1.2313
59	T	A	-0.1845
60	C	A	-0.5934
61	K	A	-1.9758