Project name: 32b8537db1d6e26

Chain sequence(s)	A: MQYKKTLVASALAATTLAAYAPSEPWSTLTPTATYSGGVTDYASTFGIAVQPISTTSSASSAATTASSKAKRAASQIGDGQVQAATTTASVSTKSTAAAVSQIGDGQIQATTKTTAAA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:31)

• Minimal score value: -2.6099
• Maximal score value: 2.3454
• Average score: -0.0023
• Total score value: -0.2738

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.6057
2	Q	A	-0.6909
3	Y	A	-0.3120
4	K	A	-1.9121
5	K	A	-1.7127
6	T	A	0.0310
7	L	A	1.7113
8	V	A	2.2835
9	A	A	1.4235
10	S	A	0.9129
11	A	A	0.9480
12	L	A	1.5619
13	A	A	0.8005
14	A	A	0.6513
15	T	A	0.5512
16	T	A	0.6977
17	L	A	1.7256
18	A	A	1.1757
19	A	A	1.1510
20	Y	A	1.5389
21	A	A	0.3399
22	P	A	-0.2385
23	S	A	-0.8084
24	E	A	-1.7019
25	P	A	-0.6537
26	W	A	0.6922
27	S	A	0.3557
28	T	A	0.7932
29	L	A	1.5388
30	T	A	0.4965
31	P	A	0.2341
32	T	A	0.0161
33	A	A	0.1944
34	T	A	0.5640
35	Y	A	1.1632
36	S	A	0.3118
37	G	A	0.0369
38	G	A	0.4316
39	V	A	1.3259
40	T	A	0.1899
41	D	A	-0.7352
42	Y	A	1.0340
43	A	A	0.3560
44	S	A	0.4024
45	T	A	1.1437
46	F	A	2.3454
47	G	A	1.1985
48	I	A	1.9124
49	A	A	0.5475
50	V	A	0.4904
51	Q	A	-0.8440
52	P	A	0.3190
53	I	A	1.5590
54	S	A	0.4680
55	T	A	0.2050
56	T	A	-0.0741
57	S	A	-0.4091
58	S	A	-0.3976
59	A	A	-0.2602
60	S	A	-0.3534
61	S	A	-0.3012
62	A	A	-0.0914
63	A	A	-0.0052
64	T	A	-0.1021
65	T	A	-0.1412
66	A	A	-0.3796
67	S	A	-0.8121
68	S	A	-1.3323
69	K	A	-2.6099
70	A	A	-2.1204
71	K	A	-2.4539
72	R	A	-1.8068
73	A	A	-0.3972
74	A	A	0.0205
75	S	A	-0.3701
76	Q	A	-1.0232
77	I	A	-0.3706
78	G	A	-1.1882
79	D	A	-2.2145
80	G	A	-1.6480
81	Q	A	-1.3748
82	V	A	-0.0940
83	Q	A	0.3339
84	A	A	0.1062
85	A	A	-0.3701
86	T	A	-0.0543
87	T	A	-0.0701
88	T	A	0.0927
89	A	A	0.3599
90	S	A	0.5913
91	V	A	1.2720
92	S	A	0.0883
93	T	A	-0.6226
94	K	A	-1.6482
95	S	A	-0.9343
96	T	A	-0.6250
97	A	A	-0.0596
98	A	A	0.1404
99	A	A	0.5380
100	V	A	1.8918
101	S	A	0.8029
102	Q	A	0.1522
103	I	A	0.2816
104	G	A	-0.9482
105	D	A	-2.0237
106	G	A	-1.7982
107	Q	A	-1.2864
108	I	A	0.5170
109	Q	A	0.2419
110	A	A	0.2850
111	T	A	-0.0151
112	T	A	-0.7898
113	K	A	-1.7660
114	T	A	-0.9338
115	T	A	-0.5396
116	A	A	-0.1780
117	A	A	0.0864
118	A	A	0.0925