Project name: Mb5-11_LVVAYL

Status: done

Started: 2026-07-06 06:29:20
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRVTYGETGGNSPVQEFTVPGSKSTATVSGLKPGVDYTATVYAVTWYPRYGYGESGPYSLNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:58)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:59)
Show buried residues

Minimal score value
-2.8039
Maximal score value
1.476
Average score
-0.7633
Total score value
-83.195

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3706
2 Q A -1.0319
3 A A -1.1229
4 N A -1.9795
5 S A -1.3459
6 G A -1.5302
7 S A -1.3043
8 L A 0.0000
9 E A -1.8469
10 V A -0.5907
11 V A 0.3387
12 E A -1.3114
13 A A -1.2585
14 S A -1.6280
15 P A -1.9665
16 T A -1.2369
17 S A -1.2217
18 L A 0.0000
19 Q A -0.8881
20 L A 0.0000
21 S A -1.0253
22 W A 0.0000
23 D A -2.2611
24 A A -1.4703
25 F A 0.0000
26 H A -1.2471
27 R A -0.3631
28 Y A 0.8366
29 H A 0.2043
30 N A -0.5919
31 G A 0.1161
32 F A 1.4760
33 T A 0.7235
34 H A 0.0000
35 P A -0.4537
36 V A -1.0638
37 R A -1.4349
38 Y A -0.9107
39 Y A 0.0000
40 R A -0.8269
41 V A 0.0000
42 T A 0.0000
43 Y A -0.4541
44 G A -0.8228
45 E A -1.6480
46 T A -1.2616
47 G A -1.2462
48 G A -1.4035
49 N A -1.5655
50 S A -0.9894
51 P A -0.4505
52 V A 0.2539
53 Q A -1.2472
54 E A -1.8250
55 F A -0.7038
56 T A -0.2036
57 V A -0.4501
58 P A -0.9827
59 G A -1.2575
60 S A -1.2352
61 K A -1.6768
62 S A -1.1598
63 T A -0.8057
64 A A 0.0000
65 T A -0.3928
66 V A 0.0000
67 S A -0.7689
68 G A -0.9877
69 L A 0.0000
70 K A -2.4436
71 P A -2.0221
72 G A -1.2940
73 V A -1.1524
74 D A -2.1637
75 Y A 0.0000
76 T A -0.8310
77 A A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.2813
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.4776
85 Y A 0.0000
86 P A -0.4559
87 R A -1.1093
88 Y A 0.7111
89 G A 0.7247
90 Y A 1.1227
91 G A 0.3331
92 E A -0.6054
93 S A 0.0000
94 G A -0.6681
95 P A -0.4930
96 Y A -0.3244
97 S A -0.5829
98 L A -0.7416
99 N A -1.7708
100 Y A -1.5903
101 R A -2.5543
102 T A 0.0000
103 E A -2.4896
104 L A -1.2537
105 D A -2.7098
106 K A -2.8039
107 P A -1.7850
108 S A -1.6442
109 Q A -1.6630
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018