Project name: 32f56b97a17573e

Chain sequence(s)	A: SKIKGSRHWGFILGFILGSRHWKRGEPPPGKPADDAGLVSRHWGFILGFILGSRHWKRGEPPPGKPADDAGLVSRHWGFILGFILGSRHWKRGEPPPGKPADDAGLVSRHWGFILGFILGSRHWKRGEPPPGKPADDAGLV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:02)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:03)

• Minimal score value: -3.4579
• Maximal score value: 2.9803
• Average score: -0.8228
• Total score value: -116.0198

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-0.7394
2	K	A	-1.3674
3	I	A	0.1304
4	K	A	-1.7606
5	G	A	-1.4255
6	S	A	-1.2943
7	R	A	-2.1944
8	H	A	-1.0959
9	W	A	0.6339
10	G	A	0.3342
11	F	A	1.4853
12	I	A	2.1607
13	L	A	2.5132
14	G	A	2.0229
15	F	A	2.9803
16	I	A	2.2280
17	L	A	1.7494
18	G	A	0.5563
19	S	A	-0.1108
20	R	A	-1.7950
21	H	A	-1.8473
22	W	A	-1.6998
23	K	A	-3.1715
24	R	A	-3.3232
25	G	A	-2.3745
26	E	A	-2.4702
27	P	A	-2.1700
28	P	A	-1.2715
29	P	A	-1.3401
30	G	A	-1.5362
31	K	A	-2.6515
32	P	A	-2.0379
33	A	A	-1.8600
34	D	A	-2.2630
35	D	A	-1.6017
36	A	A	-1.1531
37	G	A	-0.8386
38	L	A	0.1514
39	V	A	0.6726
40	S	A	-0.2814
41	R	A	-1.0154
42	H	A	-0.1151
43	W	A	0.3680
44	G	A	-0.1738
45	F	A	0.4430
46	I	A	1.1404
47	L	A	1.3277
48	G	A	0.9838
49	F	A	1.3315
50	I	A	1.8991
51	L	A	1.2462
52	G	A	0.2034
53	S	A	-0.6806
54	R	A	-2.0387
55	H	A	-2.2305
56	W	A	-2.3386
57	K	A	-3.4579
58	R	A	-3.3786
59	G	A	-2.6777
60	E	A	-2.9742
61	P	A	-1.9554
62	P	A	-1.0909
63	P	A	-1.2289
64	G	A	-1.5582
65	K	A	-2.5115
66	P	A	-1.9012
67	A	A	-1.7356
68	D	A	-2.5590
69	D	A	-2.1782
70	A	A	-1.4063
71	G	A	-0.8742
72	L	A	0.0802
73	V	A	-0.7553
74	S	A	-0.8971
75	R	A	-1.3702
76	H	A	-0.7844
77	W	A	-0.1154
78	G	A	-0.1945
79	F	A	0.3792
80	I	A	1.3180
81	L	A	2.0222
82	G	A	1.4278
83	F	A	1.7071
84	I	A	2.9413
85	L	A	2.2274
86	G	A	0.7016
87	S	A	-0.0437
88	R	A	-1.7436
89	H	A	-2.0987
90	W	A	-2.2036
91	K	A	-3.3874
92	R	A	-3.3617
93	G	A	-2.6609
94	E	A	-2.9604
95	P	A	-1.9652
96	P	A	-1.1300
97	P	A	-1.1578
98	G	A	-1.4060
99	K	A	-2.3486
100	P	A	-1.7580
101	A	A	-1.6151
102	D	A	-2.4682
103	D	A	-1.9763
104	A	A	-1.3589
105	G	A	-0.9895
106	L	A	-0.3632
107	V	A	-0.9379
108	S	A	-1.2171
109	R	A	-1.7709
110	H	A	-1.0320
111	W	A	-0.1744
112	G	A	-0.4535
113	F	A	0.5973
114	I	A	1.1947
115	L	A	1.3560
116	G	A	1.0000
117	F	A	1.7433
118	I	A	1.4673
119	L	A	1.1794
120	G	A	0.1835
121	S	A	-0.3478
122	R	A	-1.7512
123	H	A	-1.9399
124	W	A	-1.6009
125	K	A	-3.0843
126	R	A	-3.1516
127	G	A	-2.5283
128	E	A	-2.8606
129	P	A	-1.7694
130	P	A	-1.1360
131	P	A	-1.3086
132	G	A	-1.5302
133	K	A	-2.4403
134	P	A	-2.0166
135	A	A	-1.9156
136	D	A	-3.0178
137	D	A	-2.4491
138	A	A	-0.9227
139	G	A	-0.1223
140	L	A	1.8180
141	V	A	2.4222