Project name: 87_rank

Status: done

Started: 2026-05-18 11:38:56
Settings
Chain sequence(s) B: MEELEFKVWNTQAVVDHLQTMLEERPHPNPHYMHTLKGDLMFYRHELEELERELEELKEELE
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:43)
Show buried residues

Minimal score value
-4.8302
Maximal score value
0.5091
Average score
-1.9969
Total score value
-123.8106

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B -1.3234
2 E B -2.4319
3 E B -2.4624
4 L B -1.7507
5 E B -1.8090
6 F B -0.1184
7 K B -1.6603
8 V B 0.0000
9 W B 0.5091
10 N B -0.3976
11 T B 0.0000
12 Q B -1.6739
13 A B -0.8763
14 V B -0.8354
15 V B 0.0000
16 D B -2.4381
17 H B -2.1011
18 L B 0.0000
19 Q B -2.1178
20 T B -2.1961
21 M B -2.0456
22 L B -2.1077
23 E B -3.2678
24 E B -3.3681
25 R B -3.2811
26 P B -2.1435
27 H B -1.8842
28 P B -1.1291
29 N B -1.1420
30 P B -1.1689
31 H B -1.4892
32 Y B -0.6996
33 M B -1.3125
34 H B -1.8387
35 T B -1.2947
36 L B 0.0000
37 K B -1.5080
38 G B -0.9651
39 D B -1.0520
40 L B 0.0000
41 M B -0.1197
42 F B 0.4787
43 Y B -1.1304
44 R B -2.5555
45 H B -2.5557
46 E B -2.6202
47 L B -2.9766
48 E B -4.4862
49 E B -4.3250
50 L B -3.4590
51 E B -4.4955
52 R B -4.8302
53 E B -4.1837
54 L B -4.0143
55 E B -4.6990
56 E B -4.4111
57 L B -2.9651
58 K B -3.5643
59 E B -4.1372
60 E B -3.2676
61 L B -1.4581
62 E B -2.6538
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018