Project name: 331a4a0bd08dcc9

Chain sequence(s)	A: MQVQLVESGGGSVQAGGSLRLSCTASGTKELKYAAFDLGWFRQAPGQEREAVAAIDRDGGITYYADSVKGRFTISRDNAKNTVTLQMNNLKPVDTAIYYCAARRSRNRTYESWGQGTQVTVSGGGGSHHHHHHLENWSHPQFEK
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:45)

• Minimal score value: -3.9199
• Maximal score value: 1.303
• Average score: -1.0511
• Total score value: -151.3543

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.0992
2	Q	A	-1.2750
3	V	A	-1.0757
4	Q	A	-1.0142
5	L	A	0.0000
6	V	A	0.8684
7	E	A	-0.0291
8	S	A	-0.6399
9	G	A	-1.3217
10	G	A	-1.2628
11	G	A	-0.9557
12	S	A	-0.7580
13	V	A	-0.8881
14	Q	A	-1.9803
15	A	A	-1.7388
16	G	A	-1.9537
17	G	A	-1.4300
18	S	A	-1.6138
19	L	A	-1.3976
20	R	A	-2.3522
21	L	A	0.0000
22	S	A	-0.6341
23	C	A	0.0000
24	T	A	-0.2559
25	A	A	0.0000
26	S	A	-0.7664
27	G	A	-0.8842
28	T	A	-0.6548
29	K	A	-1.1405
30	E	A	0.0000
31	L	A	-0.0227
32	K	A	-1.3447
33	Y	A	0.0000
34	A	A	-1.1991
35	A	A	-1.3158
36	F	A	0.0000
37	D	A	-1.3076
38	L	A	0.0000
39	G	A	0.0000
40	W	A	0.0000
41	F	A	-0.8932
42	R	A	-1.7442
43	Q	A	-2.4929
44	A	A	-1.5210
45	P	A	-1.3167
46	G	A	-1.7996
47	Q	A	-3.1674
48	E	A	-3.9199
49	R	A	-3.7873
50	E	A	-3.2911
51	A	A	-1.3603
52	V	A	0.0000
53	A	A	0.0000
54	A	A	0.6219
55	I	A	0.0000
56	D	A	0.0000
57	R	A	-1.7877
58	D	A	-2.3558
59	G	A	-1.4161
60	G	A	-0.7067
61	I	A	0.7064
62	T	A	1.0162
63	Y	A	1.3030
64	Y	A	-0.1092
65	A	A	-1.1781
66	D	A	-2.1902
67	S	A	-1.4682
68	V	A	0.0000
69	K	A	-2.4290
70	G	A	-1.8692
71	R	A	-1.8430
72	F	A	0.0000
73	T	A	-0.8261
74	I	A	0.0000
75	S	A	-0.5101
76	R	A	-1.4269
77	D	A	-1.7430
78	N	A	-1.9676
79	A	A	-1.1346
80	K	A	-2.0063
81	N	A	-1.3978
82	T	A	-0.9384
83	V	A	0.0000
84	T	A	-0.8792
85	L	A	0.0000
86	Q	A	-1.6677
87	M	A	0.0000
88	N	A	-1.9672
89	N	A	-2.3158
90	L	A	0.0000
91	K	A	-1.5578
92	P	A	-0.3030
93	V	A	1.1240
94	D	A	0.0000
95	T	A	-0.0170
96	A	A	0.0000
97	I	A	-0.5464
98	Y	A	0.0000
99	Y	A	-0.3761
100	C	A	0.0000
101	A	A	0.0000
102	A	A	0.0000
103	R	A	-2.2212
104	R	A	-2.4652
105	S	A	-2.1647
106	R	A	-3.0833
107	N	A	-3.3724
108	R	A	-3.2805
109	T	A	-2.1298
110	Y	A	-1.6248
111	E	A	-2.3813
112	S	A	0.0000
113	W	A	-0.3859
114	G	A	-0.1948
115	Q	A	-1.0176
116	G	A	-0.6024
117	T	A	0.0000
118	Q	A	-1.4476
119	V	A	0.0000
120	T	A	-0.6166
121	V	A	0.0000
122	S	A	-1.1653
123	G	A	-1.6365
124	G	A	-1.3872
125	G	A	-1.0755
126	G	A	-1.3033
127	S	A	-1.6372
128	H	A	-2.0343
129	H	A	-2.4634
130	H	A	-2.6854
131	H	A	-2.4411
132	H	A	-2.0331
133	H	A	-1.6135
134	L	A	-0.3550
135	E	A	-1.8188
136	N	A	-1.4626
137	W	A	-0.4215
138	S	A	-0.8261
139	H	A	-1.1125
140	P	A	-0.8982
141	Q	A	-1.5682
142	F	A	-0.4036
143	E	A	-2.1842
144	K	A	-2.1386