Project name: 334046ff631df8a

Chain sequence(s)	A: EVQLVESGGGSVQPGESLRLSCAVSESIFSRDAVAWHRQAPGKGLELVAVVTIADNAYYADSVKGRFTISRDKAGNTVYLHMNALRAEDTAVYYCNAWSSIGSADYWGQGTQVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:53)

• Minimal score value: -3.0511
• Maximal score value: 1.7957
• Average score: -0.6659
• Total score value: -77.9084

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.6442
2	V	A	-0.4569
3	Q	A	-0.8600
4	L	A	0.0000
5	V	A	1.1109
6	E	A	-0.0339
7	S	A	-0.5094
8	G	A	-1.1655
9	G	A	-1.1863
10	G	A	-0.9217
11	S	A	-0.8049
12	V	A	-1.0142
13	Q	A	-1.6499
14	P	A	-2.1540
15	G	A	-1.9840
16	E	A	-2.2924
17	S	A	-1.9169
18	L	A	-1.3642
19	R	A	-1.9411
20	L	A	0.0000
21	S	A	-0.4008
22	C	A	0.0000
23	A	A	-0.0587
24	V	A	0.0000
25	S	A	-1.1932
26	E	A	-2.3263
27	S	A	-1.4142
28	I	A	0.0000
29	F	A	0.0000
30	S	A	-0.9249
31	R	A	-0.3378
32	D	A	0.0000
33	A	A	0.0000
34	V	A	0.0000
35	A	A	0.0000
36	W	A	0.0000
37	H	A	0.2333
38	R	A	-0.4403
39	Q	A	-0.8589
40	A	A	-1.3488
41	P	A	-1.1762
42	G	A	-1.4544
43	K	A	-2.1484
44	G	A	-1.0200
45	L	A	0.3457
46	E	A	-0.1911
47	L	A	0.3792
48	V	A	0.0000
49	A	A	0.0000
50	V	A	0.4564
51	V	A	0.0000
52	T	A	-0.0444
53	I	A	0.3751
54	A	A	-0.3829
55	D	A	-1.6853
56	N	A	-1.2141
57	A	A	-0.0307
58	Y	A	0.7611
59	Y	A	0.0044
60	A	A	-0.9333
61	D	A	-2.2581
62	S	A	-1.7476
63	V	A	0.0000
64	K	A	-2.4477
65	G	A	-1.8057
66	R	A	-1.4354
67	F	A	0.0000
68	T	A	-0.6286
69	I	A	0.0000
70	S	A	-0.9584
71	R	A	-1.2598
72	D	A	-1.7454
73	K	A	-2.2254
74	A	A	-1.1802
75	G	A	-1.3515
76	N	A	-1.6626
77	T	A	-0.8320
78	V	A	0.0000
79	Y	A	-0.4760
80	L	A	0.0000
81	H	A	-1.1940
82	M	A	0.0000
83	N	A	-2.0637
84	A	A	-1.7392
85	L	A	0.0000
86	R	A	-3.0511
87	A	A	-2.0099
88	E	A	-2.5001
89	D	A	0.0000
90	T	A	-1.2820
91	A	A	0.0000
92	V	A	-0.4858
93	Y	A	0.0000
94	Y	A	0.0737
95	C	A	0.0000
96	N	A	0.0000
97	A	A	0.0000
98	W	A	0.1544
99	S	A	0.4333
100	S	A	0.7177
101	I	A	1.7957
102	G	A	0.4243
103	S	A	-0.1826
104	A	A	-0.4975
105	D	A	-1.3964
106	Y	A	-0.2219
107	W	A	0.2585
108	G	A	0.0918
109	Q	A	-0.8464
110	G	A	-0.6029
111	T	A	0.0000
112	Q	A	-1.3885
113	V	A	0.0000
114	T	A	-1.0171
115	V	A	0.0000
116	S	A	-1.0062
117	S	A	-0.5400