Project name: 336199d9d4169b0

Chain sequence(s)	A: EELRAAAAELLAAAEALAEELRRLGLEEAAAHVLAAARHVAAALELIAATPASELNPELKREVAAHLREAAAHFEAAAEIVAAEDPLAGAMLREAALAARSMAAYVLHSSPEEALQQAAVFATGLAGAMLTMTGLVRERLAAR
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:07)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:07)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:07)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:07)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:07)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:08)

• Minimal score value: -3.2394
• Maximal score value: 1.4094
• Average score: -0.858
• Total score value: -122.6905

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
3	E	A	-2.5766
4	E	A	-2.3988
5	L	A	-0.9064
6	R	A	-1.9937
7	A	A	-1.5944
8	A	A	-1.7554
9	A	A	-1.1258
10	A	A	-1.1053
11	E	A	-1.5929
12	L	A	0.0000
13	L	A	-0.3455
14	A	A	-0.4729
15	A	A	0.0000
16	A	A	0.0000
17	E	A	-1.1022
18	A	A	-0.5306
19	L	A	0.0000
20	A	A	0.0000
21	E	A	-2.2522
22	E	A	-2.1061
23	L	A	0.0000
24	R	A	-2.2226
25	R	A	-2.4613
26	L	A	-1.6592
27	G	A	-0.6590
28	L	A	0.0316
29	E	A	-2.2049
30	E	A	-1.4393
31	A	A	0.0000
32	A	A	0.0000
33	A	A	-0.7952
34	H	A	-0.8341
35	V	A	0.0000
36	L	A	-0.5478
37	A	A	-0.8189
38	A	A	0.0000
39	A	A	0.0000
40	R	A	-1.7226
41	H	A	-1.5143
42	V	A	0.0000
43	A	A	-0.9392
44	A	A	-0.7941
45	A	A	0.0000
46	L	A	0.0000
47	E	A	-1.0070
48	L	A	-0.2847
49	I	A	0.0000
50	A	A	-1.0976
51	A	A	-0.7396
52	T	A	-0.8038
53	P	A	-0.9642
54	A	A	-0.9755
55	S	A	-1.3278
56	E	A	-2.6056
57	L	A	0.0000
58	N	A	-2.6566
59	P	A	-2.4544
60	E	A	-3.1071
61	L	A	-1.9120
62	K	A	-2.2101
63	R	A	-3.1191
64	E	A	-2.3581
65	V	A	0.0000
66	A	A	0.0000
67	A	A	-1.7372
68	H	A	-1.8469
69	L	A	0.0000
70	R	A	-2.1738
71	E	A	-1.9341
72	A	A	0.0000
73	A	A	0.0000
74	A	A	-1.0061
75	H	A	-0.9788
76	F	A	0.0000
77	E	A	-1.1546
78	A	A	-0.7738
79	A	A	0.0000
80	A	A	0.0000
81	E	A	-1.3121
82	I	A	0.2987
83	V	A	-0.0707
84	A	A	-0.5343
85	A	A	-0.8911
86	E	A	-1.6206
87	D	A	0.0000
88	P	A	-0.0535
89	L	A	1.0179
90	A	A	0.0000
91	G	A	0.0000
92	A	A	-0.3837
93	M	A	-0.2250
94	L	A	0.0000
95	R	A	-1.4024
96	E	A	-1.7421
97	A	A	0.0000
98	A	A	0.0000
99	L	A	0.0071
100	A	A	-0.4173
101	A	A	0.0000
102	R	A	-1.1799
103	S	A	-0.2811
104	M	A	0.0000
105	A	A	0.0000
106	A	A	-0.4066
107	Y	A	-0.3160
108	V	A	0.0000
109	L	A	-0.5472
110	H	A	-0.7856
111	S	A	-1.1215
112	S	A	-1.6247
113	P	A	-2.2397
114	E	A	-3.0723
115	E	A	-2.9609
116	A	A	0.0000
117	L	A	-1.6389
118	Q	A	-2.0420
119	Q	A	-0.8841
120	A	A	0.0000
121	A	A	-0.4348
122	V	A	0.9337
123	F	A	0.3425
124	A	A	0.0000
125	T	A	-0.0813
126	G	A	-0.1429
127	L	A	0.0000
128	A	A	0.0331
129	G	A	0.0941
130	A	A	0.0118
131	M	A	0.0000
132	L	A	1.4094
133	T	A	0.4586
134	M	A	0.0000
135	T	A	0.0000
136	G	A	-0.9310
137	L	A	-0.8666
138	V	A	0.0000
139	R	A	-3.2394
140	E	A	-3.2188
141	R	A	-2.9115
142	L	A	-2.2333
143	A	A	-1.7119
144	A	A	-1.7555
145	R	A	-2.3489