Project name: query_structure

Status: done

Started: 2026-03-17 00:01:57
Settings
Chain sequence(s) A: MAQVQLVESGGGLVQHGGSLRLSCVTSGFTFDIHDMGWFRQAPGKERDIVARISKSGDITYYADSVKGRFIISRDNTKNTVYLQMNSLKPEDTAVYYCAATLRATITSFDEYVYRGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:31)
Show buried residues

Minimal score value
-3.7873
Maximal score value
1.0157
Average score
-0.7273
Total score value
-90.1907

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.9279
2 A A 0.0993
3 Q A -0.6967
4 V A -0.0792
5 Q A -0.5060
6 L A 0.0000
7 V A 0.8712
8 E A 0.0703
9 S A -0.4409
10 G A -1.0120
11 G A -0.8120
12 G A -0.0770
13 L A 0.8386
14 V A 0.0000
15 Q A -1.7489
16 H A -2.3266
17 G A -1.7488
18 G A -1.1721
19 S A -1.2876
20 L A -1.0076
21 R A -1.9454
22 L A 0.0000
23 S A -0.2266
24 C A 0.0000
25 V A 0.7470
26 T A 0.0000
27 S A -0.1682
28 G A 0.0012
29 F A 0.1506
30 T A -0.2267
31 F A 0.0000
32 D A -1.5361
33 I A 0.1014
34 H A 0.0000
35 D A 0.0000
36 M A 0.0000
37 G A 0.0000
38 W A 0.0000
39 F A 0.0000
40 R A -1.7245
41 Q A -2.3031
42 A A -2.1031
43 P A -1.5596
44 G A -1.9334
45 K A -3.4636
46 E A -3.7873
47 R A -3.3916
48 D A -3.0455
49 I A 0.0000
50 V A 0.0000
51 A A 0.0000
52 R A 0.0000
53 I A 0.0000
54 S A -0.3435
55 K A -1.1221
56 S A -1.0727
57 G A -1.1662
58 D A -1.0842
59 I A 1.0157
60 T A 0.8904
61 Y A 0.6933
62 Y A -0.5384
63 A A 0.0000
64 D A -2.4432
65 S A -1.8486
66 V A 0.0000
67 K A -2.4110
68 G A -1.5636
69 R A -1.0367
70 F A 0.0000
71 I A 0.3071
72 I A 0.0000
73 S A -0.2573
74 R A -1.3118
75 D A -1.7541
76 N A -2.4312
77 T A -1.8900
78 K A -2.3388
79 N A -2.0089
80 T A -0.7667
81 V A 0.0000
82 Y A -0.2354
83 L A 0.0000
84 Q A -0.7488
85 M A 0.0000
86 N A -1.1304
87 S A -1.2609
88 L A 0.0000
89 K A -2.3037
90 P A -2.0271
91 E A -2.3764
92 D A 0.0000
93 T A -0.8936
94 A A 0.0000
95 V A -0.4908
96 Y A 0.0000
97 Y A 0.0000
98 C A 0.0000
99 A A 0.0000
100 A A 0.0000
101 T A 0.0000
102 L A 0.6407
103 R A -1.0616
104 A A -0.3692
105 T A -0.2288
106 I A -0.7385
107 T A -0.7630
108 S A -1.5894
109 F A -1.8473
110 D A -2.5537
111 E A -2.3249
112 Y A 0.0000
113 V A 0.6043
114 Y A -0.0095
115 R A -1.8026
116 G A 0.0000
117 Q A -1.4298
118 G A -0.9974
119 T A -0.8088
120 Q A -1.0285
121 V A 0.0000
122 T A -0.3848
123 V A 0.0000
124 S A -1.0257
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018