Project name: query_structure

Status: done

Started: 2026-03-17 01:13:25
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVVYYVITYGETGHGGYYYQEFKVPGSKSTATISGLKPGVDYTITVYAYDDEYSSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:56)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:57)
Show buried residues

Minimal score value
-3.6281
Maximal score value
1.6165
Average score
-0.6352
Total score value
-57.807

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.6165
2 S A 0.1741
3 D A -0.5738
4 V A -0.7730
5 P A 0.0000
6 R A -3.6281
7 D A -3.5976
8 L A 0.0000
9 E A -2.1923
10 V A 0.0961
11 V A 1.5432
12 A A 0.9007
13 A A 0.3112
14 T A -0.3470
15 P A -1.1377
16 T A -1.0049
17 S A -0.5332
18 L A 0.0000
19 L A 0.7527
20 I A 0.0000
21 S A -1.2014
22 W A 0.0000
23 D A -3.3863
24 A A -1.7769
25 P A 0.0000
26 A A 0.1642
27 V A 0.7042
28 T A 0.0558
29 V A 0.2049
30 V A 0.2300
31 Y A -0.1778
32 Y A 0.0000
33 V A -0.5549
34 I A 0.0000
35 T A -0.8692
36 Y A -0.5261
37 G A 0.0000
38 E A -1.4416
39 T A -1.3059
40 G A -1.2260
41 H A -1.0715
42 G A -0.5160
43 G A 0.0298
44 Y A 1.3983
45 Y A 1.1331
46 Y A 0.1584
47 Q A -1.1191
48 E A -2.0614
49 F A -1.2841
50 K A -1.6351
51 V A 0.0000
52 P A -0.7418
53 G A -0.4463
54 S A -0.8499
55 K A -1.8701
56 S A -1.4024
57 T A -0.7605
58 A A 0.0000
59 T A 0.2428
60 I A 0.0000
61 S A -0.6553
62 G A -1.0288
63 L A 0.0000
64 K A -2.3821
65 P A -1.6861
66 G A -1.4781
67 V A -1.4536
68 D A -2.2387
69 Y A 0.0000
70 T A -0.9870
71 I A 0.0000
72 T A 0.0000
73 V A 0.0000
74 Y A 0.1993
75 A A 0.0000
76 Y A -0.1799
77 D A -1.0820
78 D A -2.2717
79 E A -2.1193
80 Y A -0.3682
81 S A -0.2407
82 S A 0.0000
83 S A -0.1588
84 P A -0.2505
85 I A -0.2734
86 S A -0.6883
87 I A -0.7167
88 N A -1.7369
89 Y A -1.4858
90 R A -2.5668
91 T A -1.6617
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018