Project name: Nb_G

Chain sequence(s)	A: QVQLVESGGGLVQPGGSLRLSCAASSPQWQKSKFLAGLWFRQAPGQGLEAVASYGENKETGLGSISRDPRFTISRDNSKNTLYLQMNSLRAEDTAVYYCALGPRLMEDKEQFQLATHWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:11)

• Minimal score value: -3.9579
• Maximal score value: 1.643
• Average score: -0.7579
• Total score value: -97.0149

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.5560
2	V	A	0.0000
3	Q	A	-1.2434
4	L	A	0.0000
5	V	A	1.1259
6	E	A	0.3816
7	S	A	-0.1260
8	G	A	-0.7040
9	G	A	0.0717
10	G	A	0.8281
11	L	A	1.2985
12	V	A	0.0000
13	Q	A	-1.4682
14	P	A	-1.7131
15	G	A	-1.4504
16	G	A	-1.0032
17	S	A	-1.2944
18	L	A	-0.9481
19	R	A	-2.1459
20	L	A	0.0000
21	S	A	-0.4680
22	C	A	0.0000
23	A	A	-0.1541
24	A	A	0.0000
25	S	A	-0.7230
26	S	A	0.0000
27	P	A	-1.4292
28	Q	A	-2.4648
29	W	A	0.0000
30	Q	A	-3.4630
31	K	A	-3.3101
32	S	A	-2.3969
33	K	A	-2.5671
34	F	A	0.0000
35	L	A	-0.8223
36	A	A	0.0000
37	G	A	0.0000
38	L	A	0.0000
39	W	A	0.0000
40	F	A	0.2751
41	R	A	-0.1146
42	Q	A	-0.4846
43	A	A	-0.9299
44	P	A	-1.0211
45	G	A	-1.1965
46	Q	A	-1.6600
47	G	A	-0.8165
48	L	A	0.4767
49	E	A	-0.5056
50	A	A	-0.3428
51	V	A	0.0000
52	A	A	0.0000
53	S	A	0.0000
54	Y	A	0.3263
55	G	A	0.0000
56	E	A	-1.6273
57	N	A	-2.9111
58	K	A	-3.2890
59	E	A	-3.0067
60	T	A	-1.7273
61	G	A	-1.2911
62	L	A	-0.0869
63	G	A	0.2022
64	S	A	0.6362
65	I	A	1.3359
66	S	A	-0.2694
67	R	A	-1.7450
68	D	A	-1.1905
69	P	A	-0.8080
70	R	A	-1.0079
71	F	A	0.0000
72	T	A	-0.6161
73	I	A	0.0000
74	S	A	-0.5301
75	R	A	-1.2877
76	D	A	-2.1308
77	N	A	-2.9580
78	S	A	-2.1825
79	K	A	-2.7149
80	N	A	-2.3208
81	T	A	0.0000
82	L	A	0.0000
83	Y	A	0.0000
84	L	A	0.0000
85	Q	A	-1.3203
86	M	A	0.0000
87	N	A	-1.4110
88	S	A	-1.2154
89	L	A	0.0000
90	R	A	-2.5119
91	A	A	-1.8357
92	E	A	-2.2952
93	D	A	0.0000
94	T	A	-0.5042
95	A	A	0.0000
96	V	A	0.7551
97	Y	A	0.0000
98	Y	A	0.4811
99	C	A	0.0000
100	A	A	0.0000
101	L	A	0.0000
102	G	A	0.0000
103	P	A	-0.8739
104	R	A	-1.2799
105	L	A	-1.0603
106	M	A	-2.1802
107	E	A	-3.7958
108	D	A	-3.8888
109	K	A	-3.9579
110	E	A	-3.6697
111	Q	A	-2.4278
112	F	A	-0.3571
113	Q	A	-0.5460
114	L	A	1.2820
115	A	A	0.0000
116	T	A	0.3282
117	H	A	-0.0690
118	W	A	0.2312
119	G	A	-0.1277
120	Q	A	-0.8418
121	G	A	0.0848
122	T	A	0.5733
123	L	A	1.6430
124	V	A	0.0000
125	T	A	0.2994
126	V	A	0.0000
127	S	A	-0.7438
128	S	A	-0.5139