Project name: 3463e53fe1bf3fd

Status: done

Started: 2025-12-11 07:25:24
Settings
Chain sequence(s) A: GQSWWLPRVGAQALKSFQDEQFQGLWFVLGLAGSTHSKADRSLLSPFTATFERSGKRRLQVSYAMTRGPRCITWSYLLTPTAQPGQFSVDNSREPGALAEELQVHDTDYTTFALMVSKRQSGGQRILRVYLLCRMWAIEVKELDRFVCLLGAQGLSEDNIVFPD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:40)
Show buried residues

Minimal score value
-3.6523
Maximal score value
0.9744
Average score
-0.8283
Total score value
-135.8488

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 G A -1.0267
8 Q A -1.3074
9 S A -0.4753
10 W A 0.1524
11 W A 0.4980
12 L A 0.0767
13 P A 0.0000
14 R A -1.0062
15 V A 0.1705
16 G A -0.3353
17 A A -0.8995
18 Q A -1.5209
19 A A -1.1447
20 L A -1.2234
21 K A -2.0413
22 S A -1.1776
23 F A 0.0000
24 Q A -1.9835
25 D A 0.0000
26 E A -3.4219
27 Q A -2.1980
28 F A 0.0000
29 Q A -2.0771
30 G A -0.8626
31 L A 0.8369
32 W A 0.0000
33 F A 0.5964
34 V A 0.0000
35 L A 0.0000
36 G A 0.0000
37 L A 0.1121
38 A A 0.0000
39 G A 0.0000
40 S A -0.6589
41 T A -0.6652
42 H A -1.7656
43 S A -2.5783
44 K A -3.5818
45 A A -2.4554
46 D A -3.1507
47 R A -3.0563
48 S A -1.0628
49 L A -0.1268
50 L A -0.2994
51 S A -0.5936
52 P A 0.1307
53 F A 0.0000
54 T A 0.3879
55 A A 0.0000
56 T A -0.0393
57 F A 0.0000
58 E A -3.0235
59 R A -3.6523
60 S A -2.2935
61 G A -2.2991
62 K A -2.9682
63 R A -2.9758
64 R A -2.3570
65 L A 0.0000
66 Q A -1.4437
67 V A 0.0000
68 S A 0.0223
69 Y A 0.0000
70 A A 0.2412
71 M A 0.0000
72 T A -0.8648
73 R A -1.8991
74 G A -1.7486
75 P A -1.6460
76 R A -2.1513
77 C A -0.4869
78 I A 0.5008
79 T A 0.6706
80 W A 0.6602
81 S A 0.1639
82 Y A 0.2998
83 L A -0.7083
84 L A 0.0000
85 T A -1.0856
86 P A -0.8766
87 T A -0.4044
88 A A -0.2683
89 Q A -0.8183
90 P A -0.9421
91 G A 0.0000
92 Q A 0.0000
93 F A 0.0000
94 S A -0.8084
95 V A 0.0000
96 D A -2.0280
97 N A -1.8619
98 S A -2.2072
99 R A -3.1875
100 E A -3.0230
101 P A -1.6718
102 G A -1.4168
103 A A 0.0000
104 L A -1.0339
105 A A -1.1604
106 E A -1.0189
107 E A -0.8324
108 L A 0.0000
109 Q A 0.0000
110 V A 0.0000
111 H A 0.0000
112 D A -1.0841
113 T A -0.7315
114 D A -1.2784
115 Y A -0.5952
116 T A -0.5917
117 T A -0.5485
118 F A 0.0000
119 A A 0.0000
120 L A 0.0000
121 M A 0.0000
122 V A 0.0000
123 S A 0.0000
124 K A 0.0000
125 R A -1.2599
126 Q A -1.6350
127 S A -1.3590
128 G A -1.4502
129 G A -1.5177
130 Q A -2.1056
131 R A -1.8215
132 I A -1.0264
133 L A 0.0000
134 R A -0.4196
135 V A 0.0000
136 Y A 0.0000
137 L A 0.0000
138 L A 0.0000
139 C A 0.0000
140 R A -0.9336
141 M A 0.5237
142 W A 0.9744
143 A A 0.2788
144 I A -0.2233
145 E A -1.5046
146 V A -0.5650
147 K A -2.4749
148 E A -2.0929
149 L A -1.2470
150 D A -2.4855
151 R A -2.4460
152 F A 0.0000
153 V A -0.2117
154 C A -0.1513
155 L A 0.0000
156 L A 0.0000
157 G A -0.4351
158 A A -0.0934
159 Q A 0.0000
160 G A -0.7600
161 L A 0.0000
162 S A -1.6886
163 E A -2.6864
164 D A -2.8189
165 N A -2.0477
166 I A -1.1045
167 V A 0.0000
168 F A 0.2123
169 P A -0.4243
170 D A -1.6403
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018