Project name: VHL_R114Q

Chain sequence(s)	A: MEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVQSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:23)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:24)

• Minimal score value: -4.2108
• Maximal score value: 1.8652
• Average score: -1.1054
• Total score value: -176.8674

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.1335
2	E	A	-1.7389
3	A	A	-1.2553
4	G	A	-2.1059
5	R	A	-2.9697
6	P	A	-2.0290
7	R	A	-2.5977
8	P	A	-1.5231
9	V	A	-0.0579
10	L	A	-0.4834
11	R	A	-0.6732
12	S	A	0.0000
13	V	A	0.6819
14	N	A	-1.2877
15	S	A	-1.8815
16	R	A	-2.9241
17	E	A	-2.9314
18	P	A	-2.1273
19	S	A	0.0000
20	Q	A	-1.8318
21	V	A	0.0000
22	I	A	-0.7839
23	F	A	0.0000
24	C	A	-1.1308
25	N	A	0.0000
26	R	A	-2.1798
27	S	A	0.0000
28	P	A	-0.9727
29	R	A	-0.9208
30	V	A	-0.0363
31	V	A	0.0000
32	L	A	0.1481
33	P	A	0.0000
34	V	A	0.0000
35	W	A	-0.3653
36	L	A	0.0000
37	N	A	-1.1203
38	F	A	-0.7984
39	D	A	-2.3664
40	G	A	-1.7694
41	E	A	-2.7155
42	P	A	-1.5948
43	Q	A	-1.1059
44	P	A	-0.4934
45	Y	A	0.1528
46	P	A	-0.1567
47	T	A	0.0505
48	L	A	0.0000
49	P	A	-0.6451
50	P	A	-1.0358
51	G	A	-1.3022
52	T	A	-1.0032
53	G	A	-1.5536
54	R	A	-1.9818
55	R	A	-2.4726
56	I	A	-1.6131
57	H	A	-1.6678
58	S	A	0.0000
59	Y	A	-1.5753
60	R	A	-1.9001
61	G	A	-0.2540
62	H	A	0.0000
63	L	A	0.0000
64	W	A	0.0000
65	L	A	0.0000
66	F	A	0.0000
67	R	A	0.0000
68	D	A	0.0000
69	A	A	-0.2128
70	G	A	-0.5029
71	T	A	-0.7586
72	H	A	-0.7506
73	D	A	-0.6677
74	G	A	-0.5772
75	L	A	0.0000
76	L	A	-0.6414
77	V	A	0.0000
78	N	A	-1.4370
79	Q	A	-1.7845
80	T	A	-1.4575
81	E	A	-1.6940
82	L	A	-0.3326
83	F	A	0.0000
84	V	A	1.5903
85	P	A	0.0000
86	S	A	-0.0896
87	L	A	-0.3439
88	N	A	-0.7484
89	V	A	0.4116
90	D	A	-1.5395
91	G	A	-1.5064
92	Q	A	-1.4944
93	P	A	-0.8452
94	I	A	0.2780
95	F	A	0.4392
96	A	A	0.0000
97	N	A	-0.8653
98	I	A	0.0000
99	T	A	-0.7127
100	L	A	0.3237
101	P	A	0.8041
102	V	A	1.8652
103	Y	A	0.5759
104	T	A	0.1295
105	L	A	0.4854
106	K	A	-1.2013
107	E	A	-1.4217
108	R	A	-1.2419
109	C	A	-0.2979
110	L	A	-0.6996
111	Q	A	-0.3519
112	V	A	0.7091
113	V	A	0.7915
114	Q	A	-0.3254
115	S	A	0.5456
116	L	A	1.4070
117	V	A	-0.1019
118	K	A	-2.0536
119	P	A	-2.3962
120	E	A	-3.3993
121	N	A	-2.9448
122	Y	A	0.0000
123	R	A	-3.9638
124	R	A	-3.3465
125	L	A	-1.8092
126	D	A	-1.9829
127	I	A	-0.2314
128	V	A	0.9030
129	R	A	-1.6730
130	S	A	-0.8606
131	L	A	-1.0725
132	Y	A	0.0000
133	E	A	-3.4861
134	D	A	-2.8336
135	L	A	0.0000
136	E	A	-3.4927
137	D	A	-3.5186
138	H	A	-2.7647
139	P	A	-1.9579
140	N	A	-2.2327
141	V	A	-1.8861
142	Q	A	-2.9158
143	K	A	-3.1926
144	D	A	-2.9003
145	L	A	0.0000
146	E	A	-3.9546
147	R	A	-4.2108
148	L	A	-2.9473
149	T	A	-2.4994
150	Q	A	-3.3543
151	E	A	-3.9755
152	R	A	-3.4703
153	I	A	-1.8655
154	A	A	-2.3475
155	H	A	-3.1018
156	Q	A	-3.2246
157	R	A	-2.9564
158	M	A	-1.2422
159	G	A	-2.0463
160	D	A	-2.6452