Project name: 350ab499248b367

Status: done

Started: 2026-07-01 15:22:27
Settings
Chain sequence(s) B: MKTLSISRVVTPELAGQLFRVGFSSSPSTEALEASAAANPEVFTLRLVPP
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:18)
Show buried residues

Minimal score value
-2.3732
Maximal score value
1.8489
Average score
-0.0204
Total score value
-1.0213

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 0.2529
2 K B -0.9104
3 T B 0.2414
4 L B 1.5050
5 S B 1.3091
6 I B 1.6973
7 S B 0.3940
8 R B -0.0785
9 V B 1.6780
10 V B 1.8489
11 T B 0.4394
12 P B -0.7610
13 E B -1.7523
14 L B -0.6296
15 A B -0.6501
16 G B -1.0461
17 Q B -0.5414
18 L B 1.6391
19 F B 1.1779
20 R B -0.2258
21 V B 0.3660
22 G B 0.1942
23 F B 1.5475
24 S B 0.2873
25 S B 0.0948
26 S B -0.2454
27 P B -0.3347
28 S B -1.0143
29 T B -1.4175
30 E B -2.3732
31 A B -1.0997
32 L B -0.5713
33 E B -2.0627
34 A B -0.9990
35 S B -0.3911
36 A B -0.6879
37 A B -0.6378
38 A B -0.4341
39 N B -0.7342
40 P B -0.8091
41 E B -1.1561
42 V B 1.2460
43 F B 1.7755
44 T B 0.8846
45 L B 0.2606
46 R B -0.8199
47 L B 0.4120
48 V B 1.5454
49 P B 0.4062
50 P B 0.1588
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018