Project name: query_structure

Status: done

Started: 2025-11-29 10:11:43
Settings
Chain sequence(s) A: DTTPCGESCVWIPCVSSIVGCSCQNKVCYQN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:22)
Show buried residues

Minimal score value
-2.6089
Maximal score value
3.0511
Average score
0.0561
Total score value
1.7402

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -2.6089
2 T A -1.3964
3 T A -1.0823
4 P A -0.8803
5 C A -0.2552
6 G A -0.5718
7 E A 0.0506
8 S A 0.2597
9 C A 0.8659
10 V A 1.3165
11 W A 2.2324
12 I A 2.6118
13 P A 1.4006
14 C A 0.0000
15 V A 2.5419
16 S A 1.8211
17 S A 1.7576
18 I A 3.0511
19 V A 2.5515
20 G A 0.8484
21 C A 0.0000
22 S A -0.4947
23 C A -0.7554
24 Q A -1.8399
25 N A -2.0317
26 K A -1.5537
27 V A -0.7416
28 C A 0.0000
29 Y A -1.4859
30 Q A -1.6749
31 N A -2.1962
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018