Project name: 35c41c74c223a4

Status: done

Started: 2026-06-25 04:05:13
Settings
Chain sequence(s) A: FVNQHLCGSHLVEALYLVCGERGFFYTKPTRDADDRGIVEQCCTSICSLYQLENYCN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:42)
Show buried residues

Minimal score value
-3.6672
Maximal score value
2.073
Average score
-0.6917
Total score value
-39.4293

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
11 F A 2.0730
12 V A 1.8512
13 N A -0.1824
14 Q A -0.6292
15 H A -1.0834
16 L A -0.6099
17 C A -0.1632
18 G A -0.4393
19 S A -0.8042
20 H A -1.2529
21 L A -0.1560
22 V A 0.1634
23 E A -1.1590
24 A A 0.2429
25 L A 0.4495
26 Y A 0.1281
27 L A 1.4100
28 V A 0.7910
29 C A -0.3226
30 G A -0.9882
31 E A -2.2528
32 R A -2.2841
33 G A -0.7166
34 F A 1.0921
35 F A 0.3301
36 Y A 0.1650
37 T A -0.1524
38 K A -1.2285
39 P A -1.3753
40 T A -2.1323
41 R A -3.3686
42 D A -3.6672
43 A A -2.6867
44 D A -2.8787
45 D A -3.6319
46 R A -3.3967
47 G A -1.9162
48 I A -0.8601
49 V A -0.4862
50 E A -1.4564
51 Q A -0.8150
52 C A 0.0000
53 C A 0.0176
54 T A -0.1363
55 S A -0.2372
56 I A 0.0483
57 C A 0.0000
58 S A 0.1647
59 L A 0.9072
60 Y A 0.5613
61 Q A -0.8090
62 L A 0.0000
63 E A -1.1837
64 N A -1.7646
65 Y A -0.6839
66 C A -0.6113
67 N A -1.3027
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018