Project name: 218-414

Status: done

Started: 2025-06-27 02:54:32
Settings
Chain sequence(s) A: MDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:10)
Show buried residues

Minimal score value
-3.8468
Maximal score value
3.5872
Average score
-0.5964
Total score value
-117.4929

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.9279
2 D A 0.5749
3 V A 3.1001
4 F A 3.5872
5 I A 3.0278
6 P A 0.7767
7 K A -0.9883
8 P A -0.6218
9 F A 0.8878
10 R A -0.6110
11 A A 0.6373
12 F A 2.1561
13 A A 2.9680
14 F A 2.9622
15 V A 3.0111
16 T A 1.1225
17 F A 0.4321
18 A A -0.2672
19 D A -1.1578
20 D A -2.3893
21 Q A -1.8736
22 I A -0.1121
23 A A -0.7499
24 Q A -1.9502
25 S A -0.9477
26 L A -0.7986
27 C A -1.3046
28 G A -1.8422
29 E A -2.4099
30 D A -1.8690
31 L A 0.5863
32 I A 2.4155
33 I A 1.7881
34 K A -0.2541
35 G A 0.7104
36 I A 2.3120
37 S A 1.2965
38 V A 0.9093
39 H A -0.9401
40 I A -0.7536
41 S A -1.4781
42 N A -1.7699
43 A A -1.3851
44 E A -2.8453
45 P A -2.5270
46 K A -3.1494
47 H A -3.2292
48 N A -3.3212
49 S A -2.6200
50 N A -3.0566
51 R A -3.8468
52 Q A -3.0509
53 L A -1.5051
54 E A -3.4936
55 R A -3.3532
56 S A -1.8158
57 G A -1.8404
58 R A -2.1024
59 F A 0.1411
60 G A -0.7055
61 G A -1.3335
62 N A -1.6606
63 P A -1.3665
64 G A -0.7621
65 G A -0.2770
66 F A 0.9312
67 G A -0.7029
68 N A -1.8048
69 Q A -2.0660
70 G A -1.1477
71 G A -0.3834
72 F A 1.1068
73 G A -0.3548
74 N A -1.6535
75 S A -1.9221
76 R A -2.5544
77 G A -1.7804
78 G A -1.4007
79 G A -0.7341
80 A A -0.2293
81 G A -0.0562
82 L A 0.6146
83 G A -0.8705
84 N A -2.0602
85 N A -2.5538
86 Q A -2.5534
87 G A -1.6625
88 S A -1.1447
89 N A -1.2803
90 M A -0.0577
91 G A -0.5526
92 G A -0.7373
93 G A -0.2326
94 M A 0.5165
95 N A -0.1511
96 F A 1.7925
97 G A 0.6803
98 A A 1.1505
99 F A 2.1732
100 S A 0.7918
101 I A 0.9334
102 N A -0.4629
103 P A -0.1571
104 A A 0.2966
105 M A 0.7776
106 M A 0.6708
107 A A 0.1300
108 A A 0.3731
109 A A -0.0019
110 Q A -0.8964
111 A A -0.5236
112 A A -0.1755
113 L A -0.1156
114 Q A -0.8809
115 S A -0.1788
116 S A 0.5732
117 W A 1.2813
118 G A 0.7595
119 M A 1.7308
120 M A 2.0910
121 G A 1.0549
122 M A 1.3786
123 L A 0.9843
124 A A -0.0007
125 S A -0.9651
126 Q A -2.0297
127 Q A -2.4808
128 N A -2.8308
129 Q A -2.6929
130 S A -1.6134
131 G A -1.2785
132 P A -0.9332
133 S A -1.1383
134 G A -1.5752
135 N A -2.4721
136 N A -2.9139
137 Q A -3.0154
138 N A -2.8452
139 Q A -2.5935
140 G A -1.7333
141 N A -1.5002
142 M A -0.6438
143 Q A -2.2382
144 R A -3.1458
145 E A -3.3537
146 P A -2.5072
147 N A -2.1403
148 Q A -1.4816
149 A A -0.0363
150 F A 1.2256
151 G A -0.0532
152 S A -0.6338
153 G A -1.4445
154 N A -2.1318
155 N A -1.8116
156 S A -0.6773
157 Y A 0.4551
158 S A -0.1966
159 G A -0.6897
160 S A -1.0655
161 N A -1.7470
162 S A -1.1447
163 G A -0.6305
164 A A 0.1272
165 A A 0.9276
166 I A 2.0094
167 G A 0.9481
168 W A 1.1922
169 G A 0.1083
170 S A -0.4076
171 A A -0.5067
172 S A -0.9684
173 N A -1.5189
174 A A -0.9422
175 G A -1.0841
176 S A -0.8920
177 G A -0.6958
178 S A -0.3518
179 G A -0.0701
180 F A 0.8835
181 N A -0.7622
182 G A -0.4968
183 G A -0.1458
184 F A 1.2787
185 G A 0.3312
186 S A -0.0593
187 S A -0.1759
188 M A -0.2150
189 D A -1.9133
190 S A -1.7456
191 K A -2.3647
192 S A -1.4006
193 S A -0.7798
194 G A -0.2607
195 W A 0.8956
196 G A 0.4726
197 M A 1.0471
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018